Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4950801..4951403 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | EL138_RS24415 | Protein ID | WP_000897302.1 |
| Coordinates | 4951092..4951403 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL138_RS24410 | Protein ID | WP_000356397.1 |
| Coordinates | 4950801..4951091 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS24375 | 4946874..4947776 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| EL138_RS24380 | 4947773..4948408 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EL138_RS24385 | 4948405..4949334 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| EL138_RS24390 | 4949550..4949768 | - | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
| EL138_RS24400 | 4950164..4950442 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| EL138_RS24410 | 4950801..4951091 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL138_RS24415 | 4951092..4951403 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| EL138_RS24420 | 4951633..4952541 | + | 909 | WP_126299519.1 | alpha/beta hydrolase | - |
| EL138_RS24425 | 4952605..4953546 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| EL138_RS24430 | 4953591..4954028 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EL138_RS24435 | 4954025..4954897 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EL138_RS24440 | 4954891..4955490 | - | 600 | WP_001443191.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T287305 WP_000897302.1 NZ_LR134237:c4951403-4951092 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|