Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4380547..4380959 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | Q8FA88 |
| Locus tag | EL138_RS21750 | Protein ID | WP_000132630.1 |
| Coordinates | 4380618..4380959 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4380547..4380623 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS21740 | 4377159..4378628 | + | 1470 | WP_001315223.1 | type I restriction-modification system subunit M | - |
| EL138_RS21745 | 4378628..4380397 | + | 1770 | WP_000110076.1 | restriction endonuclease subunit S | - |
| - | 4380547..4380623 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4380547..4380623 | - | 77 | NuclAT_7 | - | Antitoxin |
| EL138_RS21750 | 4380618..4380959 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| EL138_RS21755 | 4381006..4383099 | - | 2094 | WP_000648234.1 | DUF262 domain-containing protein | - |
| EL138_RS21760 | 4383197..4383277 | - | 81 | WP_020233658.1 | hypothetical protein | - |
| EL138_RS21765 | 4383505..4384425 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EL138_RS21770 | 4384610..4385890 | + | 1281 | WP_001304526.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4364780..4383162 | 18382 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T287299 WP_000132630.1 NZ_LR134237:4380618-4380959 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT287299 NZ_LR134237:c4380623-4380547 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|