Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4299322..4299580 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | EL138_RS21360 | Protein ID | WP_000809168.1 |
| Coordinates | 4299428..4299580 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4299322..4299379 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS21345 | 4295151..4296410 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
| EL138_RS21350 | 4296539..4298032 | - | 1494 | WP_001443162.1 | sulfatase-like hydrolase/transferase | - |
| EL138_RS21355 | 4298052..4298813 | - | 762 | WP_001274832.1 | hypothetical protein | - |
| - | 4299322..4299379 | - | 58 | - | - | Antitoxin |
| EL138_RS21360 | 4299428..4299580 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| EL138_RS21365 | 4299685..4300815 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| EL138_RS21370 | 4300904..4302820 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| EL138_RS21375 | 4303192..4303596 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
| EL138_RS21380 | 4303622..4304335 | + | 714 | WP_001102391.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T287298 WP_000809168.1 NZ_LR134237:4299428-4299580 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT287298 NZ_LR134237:c4299379-4299322 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|