Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 621464..622263 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q8FDB4 |
| Locus tag | EL138_RS03065 | Protein ID | WP_000347252.1 |
| Coordinates | 621464..621928 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | EL138_RS03070 | Protein ID | WP_001296435.1 |
| Coordinates | 621928..622263 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS03035 | 616465..616899 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
| EL138_RS03040 | 616917..617795 | - | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| EL138_RS03045 | 617785..618564 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| EL138_RS03050 | 618575..619048 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| EL138_RS03055 | 619071..620351 | - | 1281 | WP_000681926.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| EL138_RS03060 | 620600..621409 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| EL138_RS03065 | 621464..621928 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| EL138_RS03070 | 621928..622263 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| EL138_RS03075 | 622412..623983 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
| EL138_RS03080 | 624358..625692 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| EL138_RS03085 | 625708..626478 | + | 771 | WP_001058223.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T287284 WP_000347252.1 NZ_LR134237:c621928-621464 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|