Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3717065..3717759 Replicon chromosome
Accession NZ_LR134236
Organism Escherichia coli strain NCTC9008

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL127_RS18265 Protein ID WP_001263493.1
Coordinates 3717065..3717463 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL127_RS18270 Protein ID WP_000554757.1
Coordinates 3717466..3717759 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL127_RS18235 3712065..3713309 - 1245 WP_000189541.1 esterase FrsA -
- 3712725..3712805 - 81 NuclAT_10 - -
- 3712725..3712805 - 81 NuclAT_10 - -
- 3712725..3712805 - 81 NuclAT_10 - -
- 3712725..3712805 - 81 NuclAT_10 - -
EL127_RS18240 3713401..3713859 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL127_RS18245 3714120..3715577 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
EL127_RS18250 3715634..3716155 - 522 Protein_3545 peptide chain release factor H -
EL127_RS18255 3716154..3716357 - 204 Protein_3546 RNA ligase RtcB family protein -
EL127_RS18260 3716603..3717055 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL127_RS18265 3717065..3717463 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL127_RS18270 3717466..3717759 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL127_RS18275 3717811..3718866 - 1056 WP_001226164.1 DNA polymerase IV -
EL127_RS18280 3718937..3719722 - 786 WP_000207549.1 putative lateral flagellar export/assembly protein LafU -
EL127_RS18285 3719694..3721406 + 1713 Protein_3552 flagellar biosynthesis protein FlhA -
EL127_RS18290 3721622..3722119 - 498 WP_000006261.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / gmhA/lpcA 3682872..3738709 55837


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T287277 WP_001263493.1 NZ_LR134236:c3717463-3717065 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT287277 WP_000554757.1 NZ_LR134236:c3717759-3717466 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References