Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 653820..654547 | Replicon | chromosome |
| Accession | NZ_LR134236 | ||
| Organism | Escherichia coli strain NCTC9008 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | EL127_RS03205 | Protein ID | WP_000550189.1 |
| Coordinates | 653820..654134 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL127_RS03210 | Protein ID | WP_000560255.1 |
| Coordinates | 654131..654547 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL127_RS03185 | 649986..650972 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| EL127_RS03190 | 651051..651734 | - | 684 | WP_001183041.1 | vancomycin high temperature exclusion protein | - |
| EL127_RS03195 | 651811..652314 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| EL127_RS03200 | 652399..653535 | + | 1137 | WP_000018690.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| EL127_RS03205 | 653820..654134 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| EL127_RS03210 | 654131..654547 | + | 417 | WP_000560255.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| EL127_RS03215 | 654592..656610 | - | 2019 | WP_000121450.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| EL127_RS03220 | 656936..659287 | - | 2352 | WP_000695495.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T287261 WP_000550189.1 NZ_LR134236:653820-654134 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14951.41 Da Isoelectric Point: 4.5577
>AT287261 WP_000560255.1 NZ_LR134236:654131-654547 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|