Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 604307..605106 | Replicon | chromosome |
Accession | NZ_LR134236 | ||
Organism | Escherichia coli strain NCTC9008 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | EL127_RS02960 | Protein ID | WP_000347251.1 |
Coordinates | 604307..604771 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EL127_RS02965 | Protein ID | WP_001307405.1 |
Coordinates | 604771..605106 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL127_RS02930 | 599308..599742 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
EL127_RS02935 | 599760..600638 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EL127_RS02940 | 600628..601407 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EL127_RS02945 | 601418..601891 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EL127_RS02950 | 601914..603194 | - | 1281 | WP_000681905.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EL127_RS02955 | 603443..604252 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EL127_RS02960 | 604307..604771 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EL127_RS02965 | 604771..605106 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EL127_RS02970 | 605255..606826 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
EL127_RS02975 | 607201..608535 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
EL127_RS02980 | 608551..609321 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T287260 WP_000347251.1 NZ_LR134236:c604771-604307 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |