Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2993157..2993803 | Replicon | chromosome |
| Accession | NZ_LR134235 | ||
| Organism | Klebsiella variicola strain NCTC9668 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL159_RS14800 | Protein ID | WP_063105971.1 |
| Coordinates | 2993157..2993504 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1F2LZT5 |
| Locus tag | EL159_RS14805 | Protein ID | WP_008806992.1 |
| Coordinates | 2993504..2993803 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL159_RS14790 | 2989044..2990477 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
| EL159_RS14795 | 2990495..2992942 | + | 2448 | WP_008806990.1 | glycogen phosphorylase | - |
| EL159_RS14800 | 2993157..2993504 | + | 348 | WP_063105971.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL159_RS14805 | 2993504..2993803 | + | 300 | WP_008806992.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EL159_RS14810 | 2993866..2995374 | - | 1509 | WP_004202136.1 | glycerol-3-phosphate dehydrogenase | - |
| EL159_RS14815 | 2995579..2995908 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
| EL159_RS14820 | 2995959..2996789 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
| EL159_RS14825 | 2996839..2997598 | + | 760 | Protein_2787 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13476.47 Da Isoelectric Point: 6.2327
>T287253 WP_063105971.1 NZ_LR134235:2993157-2993504 [Klebsiella variicola]
MWDAETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDAETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|