Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 128273..128776 Replicon chromosome
Accession NZ_LR134235
Organism Klebsiella variicola strain NCTC9668

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag EL159_RS28685 Protein ID WP_117131046.1
Coordinates 128273..128425 (+) Length 51 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag EL159_RS00805 Protein ID WP_012540018.1
Coordinates 128474..128776 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL159_RS00765 123574..124694 + 1121 Protein_136 IS3 family transposase -
EL159_RS00770 124753..124998 + 246 WP_181938877.1 hemagglutinin -
EL159_RS00775 125004..125366 + 363 WP_086070830.1 DUF596 domain-containing protein -
EL159_RS00785 125587..126099 + 513 Protein_139 hemagglutinin repeat-containing protein -
EL159_RS00790 126205..127377 + 1173 WP_117131072.1 IS21 family transposase -
EL159_RS00795 127377..128177 + 801 WP_080929196.1 IS21-like element helper ATPase IstB -
EL159_RS28685 128273..128425 + 153 WP_117131046.1 hypothetical protein Toxin
EL159_RS00805 128474..128776 + 303 WP_012540018.1 helix-turn-helix domain-containing protein Antitoxin
EL159_RS00810 128819..129103 - 285 WP_065810614.1 hypothetical protein -
EL159_RS00815 129392..129934 - 543 WP_012539969.1 GNAT family N-acetyltransferase -
EL159_RS00820 129959..130294 - 336 WP_032700858.1 TonB family protein -
EL159_RS00825 130520..130681 - 162 Protein_147 transposase -
EL159_RS00830 131212..131850 - 639 WP_072123617.1 glutathione S-transferase family protein -
EL159_RS00835 132250..132672 + 423 Protein_149 SOS response-associated peptidase family protein -
EL159_RS00840 132774..133295 - 522 WP_117131048.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - iroN 80925..468855 387930
- inside IScluster/Tn - - 123712..130681 6969


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(2-49)

Antitoxin

Cro/C1-type helix-turn-helix domain

(39-83)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5726.87 Da        Isoelectric Point: 10.6362

>T287248 WP_117131046.1 NZ_LR134235:128273-128425 [Klebsiella variicola]
MGKRGGVRVIYYVRLASGRLYLLLIYPKNAKDDLSEKEKAVMKALTQQLK

Download         Length: 153 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11226.13 Da        Isoelectric Point: 6.8718

>AT287248 WP_012540018.1 NZ_LR134235:128474-128776 [Klebsiella variicola]
MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKHAGMKQAEFAEVVGASVDLVRSWEQQRRIPSGIALK
MLCLIEREPALIDTLRGIHV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References