Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 72186..72910 | Replicon | chromosome |
Accession | NZ_LR134235 | ||
Organism | Klebsiella variicola strain NCTC9668 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2J4YLV3 |
Locus tag | EL159_RS00435 | Protein ID | WP_023292165.1 |
Coordinates | 72186..72497 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL159_RS00440 | Protein ID | WP_072122726.1 |
Coordinates | 72494..72910 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL159_RS00415 | 68195..69097 | - | 903 | WP_060598839.1 | LysR family transcriptional regulator | - |
EL159_RS00420 | 69380..70519 | + | 1140 | WP_072122725.1 | PLP-dependent aspartate aminotransferase family protein | - |
EL159_RS00425 | 70540..71469 | + | 930 | WP_158236771.1 | DMT family transporter | - |
EL159_RS00430 | 71583..71881 | + | 299 | Protein_73 | DDE-type integrase/transposase/recombinase | - |
EL159_RS00435 | 72186..72497 | + | 312 | WP_023292165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
EL159_RS00440 | 72494..72910 | + | 417 | WP_072122726.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL159_RS00445 | 73727..74107 | + | 381 | WP_077138875.1 | hypothetical protein | - |
EL159_RS00450 | 74173..74520 | + | 348 | WP_077138876.1 | hypothetical protein | - |
EL159_RS00455 | 74612..74842 | + | 231 | WP_023340951.1 | hypothetical protein | - |
EL159_RS00460 | 74889..75722 | + | 834 | WP_060598878.1 | type I restriction-modification system subunit M | - |
EL159_RS00465 | 76347..76877 | + | 531 | Protein_80 | antirestriction protein | - |
EL159_RS00470 | 76915..77394 | - | 480 | WP_060598877.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12497.32 Da Isoelectric Point: 9.9242
>T287247 WP_023292165.1 NZ_LR134235:72186-72497 [Klebsiella variicola]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15468.55 Da Isoelectric Point: 4.4711
>AT287247 WP_072122726.1 NZ_LR134235:72494-72910 [Klebsiella variicola]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDTWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDTWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|