Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3385685..3386287 | Replicon | chromosome |
Accession | NZ_LR134234 | ||
Organism | Escherichia coli strain NCTC8623 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EL131_RS16700 | Protein ID | WP_000897305.1 |
Coordinates | 3385685..3385996 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL131_RS16705 | Protein ID | WP_000356397.1 |
Coordinates | 3385997..3386287 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL131_RS16670 | 3380715..3381500 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
EL131_RS16675 | 3381599..3382198 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
EL131_RS16680 | 3382192..3383064 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
EL131_RS16685 | 3383061..3383498 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL131_RS16690 | 3383543..3384484 | + | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
EL131_RS16695 | 3384548..3385456 | - | 909 | WP_001299484.1 | alpha/beta hydrolase | - |
EL131_RS16700 | 3385685..3385996 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EL131_RS16705 | 3385997..3386287 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL131_RS16710 | 3386892..3387110 | + | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EL131_RS16715 | 3387329..3387571 | + | 243 | WP_001087409.1 | hypothetical protein | - |
EL131_RS16720 | 3387901..3388830 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
EL131_RS16725 | 3388827..3389462 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL131_RS16730 | 3389459..3390361 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T287241 WP_000897305.1 NZ_LR134234:3385685-3385996 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|