Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2578824..2579623 | Replicon | chromosome |
Accession | NZ_LR134234 | ||
Organism | Escherichia coli strain NCTC8623 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A6H2GMC5 |
Locus tag | EL131_RS12720 | Protein ID | WP_000347279.1 |
Coordinates | 2579159..2579623 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EL131_RS12715 | Protein ID | WP_001307405.1 |
Coordinates | 2578824..2579159 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL131_RS12700 | 2574609..2575379 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
EL131_RS12705 | 2575395..2576729 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
EL131_RS12710 | 2577104..2578675 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
EL131_RS12715 | 2578824..2579159 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EL131_RS12720 | 2579159..2579623 | + | 465 | WP_000347279.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EL131_RS12725 | 2579678..2580487 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EL131_RS12730 | 2580736..2582016 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EL131_RS12735 | 2582039..2582512 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EL131_RS12740 | 2582523..2583302 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EL131_RS12745 | 2583292..2584170 | + | 879 | WP_001298758.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EL131_RS12750 | 2584188..2584622 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2566670..2579623 | 12953 | |
- | inside | Genomic island | - | - | 2568397..2579623 | 11226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17869.24 Da Isoelectric Point: 9.4947
>T287239 WP_000347279.1 NZ_LR134234:2579159-2579623 [Escherichia coli]
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2GMC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |