Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 391181..391403 | Replicon | chromosome |
| Accession | NZ_LR134234 | ||
| Organism | Escherichia coli strain NCTC8623 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | EL131_RS01960 | Protein ID | WP_000170965.1 |
| Coordinates | 391181..391288 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 391336..391403 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL131_RS01930 | 387036..387869 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| EL131_RS01935 | 387866..388258 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| EL131_RS01940 | 388262..389071 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| EL131_RS01945 | 389107..389961 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| EL131_RS01950 | 390110..390217 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 390265..390331 | + | 67 | NuclAT_25 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_25 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_25 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_25 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_27 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_27 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_27 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_27 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_29 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_29 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_29 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_29 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_31 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_31 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_31 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_31 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_33 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_33 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_33 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_33 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_35 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_35 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_35 | - | - |
| - | 390265..390331 | + | 67 | NuclAT_35 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_38 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_38 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_38 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_38 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_40 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_40 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_40 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_40 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_42 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_42 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_42 | - | - |
| - | 390267..390330 | + | 64 | NuclAT_42 | - | - |
| EL131_RS01955 | 390645..390752 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 390805..390866 | + | 62 | NuclAT_37 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_37 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_37 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_37 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_39 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_39 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_39 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_39 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_41 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_41 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_41 | - | - |
| - | 390805..390866 | + | 62 | NuclAT_41 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_26 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_26 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_26 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_26 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_28 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_28 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_28 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_28 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_30 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_30 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_30 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_30 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_32 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_32 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_32 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_32 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_34 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_34 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_34 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_34 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_36 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_36 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_36 | - | - |
| - | 390805..390867 | + | 63 | NuclAT_36 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_14 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_14 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_14 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_14 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_16 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_16 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_16 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_16 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_18 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_18 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_18 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_18 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_20 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_20 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_20 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_20 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_22 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_22 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_22 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_22 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_24 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_24 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_24 | - | - |
| - | 390805..390868 | + | 64 | NuclAT_24 | - | - |
| EL131_RS01960 | 391181..391288 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 391336..391403 | + | 68 | NuclAT_13 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_13 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_13 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_13 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_15 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_15 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_15 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_15 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_21 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_21 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_21 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_21 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 391336..391403 | + | 68 | NuclAT_23 | - | Antitoxin |
| EL131_RS01965 | 391693..392793 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| EL131_RS01970 | 393063..393293 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| EL131_RS01975 | 393451..394146 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| EL131_RS01980 | 394190..394543 | - | 354 | WP_001169671.1 | DsrE/F sulfur relay family protein YchN | - |
| EL131_RS01985 | 394728..396122 | + | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T287226 WP_000170965.1 NZ_LR134234:c391288-391181 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT287226 NZ_LR134234:391336-391403 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|