Detailed information of TA system TA287226

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-ohsC/Ldr(toxin)
• Location: 391181..391403
• Replicon: chromosome
• Accession: NZ_LR134234
• Organism: Escherichia coli strain NCTC8623

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: EL131_RS01960
• Protein ID: WP_000170965.1
• Coordinates: 391181..391288 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	ohsC
Locus tag	-
Coordinates	391336..391403 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EL131_RS01930	387036..387869	+	834	WP_000456467.1	peptide chain release factor N(5)-glutamine methyltransferase	-
EL131_RS01935	387866..388258	+	393	WP_000200378.1	invasion regulator SirB2	-
EL131_RS01940	388262..389071	+	810	WP_001257044.1	invasion regulator SirB1	-
EL131_RS01945	389107..389961	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
EL131_RS01950	390110..390217	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	390265..390331	+	67	NuclAT_25	-	-
-	390265..390331	+	67	NuclAT_25	-	-
-	390265..390331	+	67	NuclAT_25	-	-
-	390265..390331	+	67	NuclAT_25	-	-
-	390265..390331	+	67	NuclAT_27	-	-
-	390265..390331	+	67	NuclAT_27	-	-
-	390265..390331	+	67	NuclAT_27	-	-
-	390265..390331	+	67	NuclAT_27	-	-
-	390265..390331	+	67	NuclAT_29	-	-
-	390265..390331	+	67	NuclAT_29	-	-
-	390265..390331	+	67	NuclAT_29	-	-
-	390265..390331	+	67	NuclAT_29	-	-
-	390265..390331	+	67	NuclAT_31	-	-
-	390265..390331	+	67	NuclAT_31	-	-
-	390265..390331	+	67	NuclAT_31	-	-
-	390265..390331	+	67	NuclAT_31	-	-
-	390265..390331	+	67	NuclAT_33	-	-
-	390265..390331	+	67	NuclAT_33	-	-
-	390265..390331	+	67	NuclAT_33	-	-
-	390265..390331	+	67	NuclAT_33	-	-
-	390265..390331	+	67	NuclAT_35	-	-
-	390265..390331	+	67	NuclAT_35	-	-
-	390265..390331	+	67	NuclAT_35	-	-
-	390265..390331	+	67	NuclAT_35	-	-
-	390267..390330	+	64	NuclAT_38	-	-
-	390267..390330	+	64	NuclAT_38	-	-
-	390267..390330	+	64	NuclAT_38	-	-
-	390267..390330	+	64	NuclAT_38	-	-
-	390267..390330	+	64	NuclAT_40	-	-
-	390267..390330	+	64	NuclAT_40	-	-
-	390267..390330	+	64	NuclAT_40	-	-
-	390267..390330	+	64	NuclAT_40	-	-
-	390267..390330	+	64	NuclAT_42	-	-
-	390267..390330	+	64	NuclAT_42	-	-
-	390267..390330	+	64	NuclAT_42	-	-
-	390267..390330	+	64	NuclAT_42	-	-
EL131_RS01955	390645..390752	-	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	390805..390866	+	62	NuclAT_37	-	-
-	390805..390866	+	62	NuclAT_37	-	-
-	390805..390866	+	62	NuclAT_37	-	-
-	390805..390866	+	62	NuclAT_37	-	-
-	390805..390866	+	62	NuclAT_39	-	-
-	390805..390866	+	62	NuclAT_39	-	-
-	390805..390866	+	62	NuclAT_39	-	-
-	390805..390866	+	62	NuclAT_39	-	-
-	390805..390866	+	62	NuclAT_41	-	-
-	390805..390866	+	62	NuclAT_41	-	-
-	390805..390866	+	62	NuclAT_41	-	-
-	390805..390866	+	62	NuclAT_41	-	-
-	390805..390867	+	63	NuclAT_26	-	-
-	390805..390867	+	63	NuclAT_26	-	-
-	390805..390867	+	63	NuclAT_26	-	-
-	390805..390867	+	63	NuclAT_26	-	-
-	390805..390867	+	63	NuclAT_28	-	-
-	390805..390867	+	63	NuclAT_28	-	-
-	390805..390867	+	63	NuclAT_28	-	-
-	390805..390867	+	63	NuclAT_28	-	-
-	390805..390867	+	63	NuclAT_30	-	-
-	390805..390867	+	63	NuclAT_30	-	-
-	390805..390867	+	63	NuclAT_30	-	-
-	390805..390867	+	63	NuclAT_30	-	-
-	390805..390867	+	63	NuclAT_32	-	-
-	390805..390867	+	63	NuclAT_32	-	-
-	390805..390867	+	63	NuclAT_32	-	-
-	390805..390867	+	63	NuclAT_32	-	-
-	390805..390867	+	63	NuclAT_34	-	-
-	390805..390867	+	63	NuclAT_34	-	-
-	390805..390867	+	63	NuclAT_34	-	-
-	390805..390867	+	63	NuclAT_34	-	-
-	390805..390867	+	63	NuclAT_36	-	-
-	390805..390867	+	63	NuclAT_36	-	-
-	390805..390867	+	63	NuclAT_36	-	-
-	390805..390867	+	63	NuclAT_36	-	-
-	390805..390868	+	64	NuclAT_14	-	-
-	390805..390868	+	64	NuclAT_14	-	-
-	390805..390868	+	64	NuclAT_14	-	-
-	390805..390868	+	64	NuclAT_14	-	-
-	390805..390868	+	64	NuclAT_16	-	-
-	390805..390868	+	64	NuclAT_16	-	-
-	390805..390868	+	64	NuclAT_16	-	-
-	390805..390868	+	64	NuclAT_16	-	-
-	390805..390868	+	64	NuclAT_18	-	-
-	390805..390868	+	64	NuclAT_18	-	-
-	390805..390868	+	64	NuclAT_18	-	-
-	390805..390868	+	64	NuclAT_18	-	-
-	390805..390868	+	64	NuclAT_20	-	-
-	390805..390868	+	64	NuclAT_20	-	-
-	390805..390868	+	64	NuclAT_20	-	-
-	390805..390868	+	64	NuclAT_20	-	-
-	390805..390868	+	64	NuclAT_22	-	-
-	390805..390868	+	64	NuclAT_22	-	-
-	390805..390868	+	64	NuclAT_22	-	-
-	390805..390868	+	64	NuclAT_22	-	-
-	390805..390868	+	64	NuclAT_24	-	-
-	390805..390868	+	64	NuclAT_24	-	-
-	390805..390868	+	64	NuclAT_24	-	-
-	390805..390868	+	64	NuclAT_24	-	-
EL131_RS01960	391181..391288	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	391336..391403	+	68	NuclAT_13	-	Antitoxin
-	391336..391403	+	68	NuclAT_13	-	Antitoxin
-	391336..391403	+	68	NuclAT_13	-	Antitoxin
-	391336..391403	+	68	NuclAT_13	-	Antitoxin
-	391336..391403	+	68	NuclAT_15	-	Antitoxin
-	391336..391403	+	68	NuclAT_15	-	Antitoxin
-	391336..391403	+	68	NuclAT_15	-	Antitoxin
-	391336..391403	+	68	NuclAT_15	-	Antitoxin
-	391336..391403	+	68	NuclAT_17	-	Antitoxin
-	391336..391403	+	68	NuclAT_17	-	Antitoxin
-	391336..391403	+	68	NuclAT_17	-	Antitoxin
-	391336..391403	+	68	NuclAT_17	-	Antitoxin
-	391336..391403	+	68	NuclAT_19	-	Antitoxin
-	391336..391403	+	68	NuclAT_19	-	Antitoxin
-	391336..391403	+	68	NuclAT_19	-	Antitoxin
-	391336..391403	+	68	NuclAT_19	-	Antitoxin
-	391336..391403	+	68	NuclAT_21	-	Antitoxin
-	391336..391403	+	68	NuclAT_21	-	Antitoxin
-	391336..391403	+	68	NuclAT_21	-	Antitoxin
-	391336..391403	+	68	NuclAT_21	-	Antitoxin
-	391336..391403	+	68	NuclAT_23	-	Antitoxin
-	391336..391403	+	68	NuclAT_23	-	Antitoxin
-	391336..391403	+	68	NuclAT_23	-	Antitoxin
-	391336..391403	+	68	NuclAT_23	-	Antitoxin
EL131_RS01965	391693..392793	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
EL131_RS01970	393063..393293	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
EL131_RS01975	393451..394146	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
EL131_RS01980	394190..394543	-	354	WP_001169671.1	DsrE/F sulfur relay family protein YchN	-
EL131_RS01985	394728..396122	+	1395	WP_000086213.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T287226 WP_000170965.1 NZ_LR134234:c391288-391181 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 68 bp

>AT287226 NZ_LR134234:391336-391403 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin