Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3574494..3575188 | Replicon | chromosome |
| Accession | NZ_LR134231 | ||
| Organism | Escherichia coli strain NCTC9087 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | EL105_RS17440 | Protein ID | WP_001263489.1 |
| Coordinates | 3574494..3574892 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | EL105_RS17445 | Protein ID | WP_000554758.1 |
| Coordinates | 3574895..3575188 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3570082..3570162 | - | 81 | NuclAT_12 | - | - |
| - | 3570082..3570162 | - | 81 | NuclAT_12 | - | - |
| - | 3570082..3570162 | - | 81 | NuclAT_12 | - | - |
| - | 3570082..3570162 | - | 81 | NuclAT_12 | - | - |
| EL105_RS17415 | 3570758..3571216 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL105_RS17420 | 3571477..3572934 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| EL105_RS17425 | 3572991..3573512 | - | 522 | Protein_3390 | peptide chain release factor H | - |
| EL105_RS17430 | 3573508..3573714 | - | 207 | Protein_3391 | RtcB family protein | - |
| EL105_RS17435 | 3574032..3574484 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| EL105_RS17440 | 3574494..3574892 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL105_RS17445 | 3574895..3575188 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL105_RS17450 | 3575240..3576295 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL105_RS17455 | 3576366..3577151 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL105_RS17460 | 3577123..3578835 | + | 1713 | Protein_3397 | flagellar biosynthesis protein FlhA | - |
| EL105_RS17465 | 3579059..3579556 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagW/ecpD / yagV/ecpE / gmhA/lpcA / rhs/PAAR / rhs/PAAR / tssA / hcp1/tssD1 | 3532130..3602708 | 70578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T287221 WP_001263489.1 NZ_LR134231:c3574892-3574494 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |