Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3574494..3575188 Replicon chromosome
Accession NZ_LR134231
Organism Escherichia coli strain NCTC9087

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag EL105_RS17440 Protein ID WP_001263489.1
Coordinates 3574494..3574892 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag EL105_RS17445 Protein ID WP_000554758.1
Coordinates 3574895..3575188 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- 3570082..3570162 - 81 NuclAT_12 - -
- 3570082..3570162 - 81 NuclAT_12 - -
- 3570082..3570162 - 81 NuclAT_12 - -
- 3570082..3570162 - 81 NuclAT_12 - -
EL105_RS17415 3570758..3571216 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL105_RS17420 3571477..3572934 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
EL105_RS17425 3572991..3573512 - 522 Protein_3390 peptide chain release factor H -
EL105_RS17430 3573508..3573714 - 207 Protein_3391 RtcB family protein -
EL105_RS17435 3574032..3574484 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
EL105_RS17440 3574494..3574892 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL105_RS17445 3574895..3575188 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL105_RS17450 3575240..3576295 - 1056 WP_001226164.1 DNA polymerase IV -
EL105_RS17455 3576366..3577151 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
EL105_RS17460 3577123..3578835 + 1713 Protein_3397 flagellar biosynthesis protein FlhA -
EL105_RS17465 3579059..3579556 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagW/ecpD / yagV/ecpE / gmhA/lpcA / rhs/PAAR / rhs/PAAR / tssA / hcp1/tssD1 3532130..3602708 70578


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T287221 WP_001263489.1 NZ_LR134231:c3574892-3574494 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT287221 WP_000554758.1 NZ_LR134231:c3575188-3574895 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References