Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3854405..3855099 | Replicon | chromosome |
| Accession | NZ_LR134228 | ||
| Organism | Escherichia coli strain NCTC9699 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | EL118_RS18840 | Protein ID | WP_001263493.1 |
| Coordinates | 3854405..3854803 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | EL118_RS18845 | Protein ID | WP_000554757.1 |
| Coordinates | 3854806..3855099 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL118_RS18810 | 3849405..3850649 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3850065..3850145 | - | 81 | NuclAT_11 | - | - |
| - | 3850065..3850145 | - | 81 | NuclAT_11 | - | - |
| - | 3850065..3850145 | - | 81 | NuclAT_11 | - | - |
| - | 3850065..3850145 | - | 81 | NuclAT_11 | - | - |
| EL118_RS18815 | 3850741..3851199 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL118_RS18820 | 3851460..3852917 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| EL118_RS18825 | 3852974..3853495 | - | 522 | Protein_3653 | peptide chain release factor H | - |
| EL118_RS18830 | 3853494..3853697 | - | 204 | Protein_3654 | RNA ligase RtcB family protein | - |
| EL118_RS18835 | 3853943..3854395 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| EL118_RS18840 | 3854405..3854803 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL118_RS18845 | 3854806..3855099 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL118_RS18850 | 3855151..3856206 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL118_RS18855 | 3856277..3857062 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL118_RS18860 | 3857034..3858746 | + | 1713 | Protein_3660 | flagellar biosynthesis protein FlhA | - |
| EL118_RS18865 | 3858970..3859467 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3853443..3869666 | 16223 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T287204 WP_001263493.1 NZ_LR134228:c3854803-3854405 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|