Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3854405..3855099 Replicon chromosome
Accession NZ_LR134228
Organism Escherichia coli strain NCTC9699

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL118_RS18840 Protein ID WP_001263493.1
Coordinates 3854405..3854803 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL118_RS18845 Protein ID WP_000554757.1
Coordinates 3854806..3855099 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL118_RS18810 3849405..3850649 - 1245 WP_000189541.1 esterase FrsA -
- 3850065..3850145 - 81 NuclAT_11 - -
- 3850065..3850145 - 81 NuclAT_11 - -
- 3850065..3850145 - 81 NuclAT_11 - -
- 3850065..3850145 - 81 NuclAT_11 - -
EL118_RS18815 3850741..3851199 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL118_RS18820 3851460..3852917 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
EL118_RS18825 3852974..3853495 - 522 Protein_3653 peptide chain release factor H -
EL118_RS18830 3853494..3853697 - 204 Protein_3654 RNA ligase RtcB family protein -
EL118_RS18835 3853943..3854395 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL118_RS18840 3854405..3854803 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL118_RS18845 3854806..3855099 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL118_RS18850 3855151..3856206 - 1056 WP_001226164.1 DNA polymerase IV -
EL118_RS18855 3856277..3857062 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
EL118_RS18860 3857034..3858746 + 1713 Protein_3660 flagellar biosynthesis protein FlhA -
EL118_RS18865 3858970..3859467 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3853443..3869666 16223


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T287204 WP_001263493.1 NZ_LR134228:c3854803-3854405 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT287204 WP_000554757.1 NZ_LR134228:c3855099-3854806 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References