Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3537282..3537976 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | EL093_RS17320 | Protein ID | WP_001263489.1 |
Coordinates | 3537282..3537680 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | EL093_RS17325 | Protein ID | WP_000554758.1 |
Coordinates | 3537683..3537976 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 3532870..3532950 | - | 81 | NuclAT_9 | - | - |
- | 3532870..3532950 | - | 81 | NuclAT_9 | - | - |
- | 3532870..3532950 | - | 81 | NuclAT_9 | - | - |
- | 3532870..3532950 | - | 81 | NuclAT_9 | - | - |
EL093_RS17295 | 3533546..3534004 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
EL093_RS17300 | 3534265..3535722 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
EL093_RS17305 | 3535779..3536300 | - | 522 | Protein_3360 | peptide chain release factor H | - |
EL093_RS17310 | 3536296..3536502 | - | 207 | Protein_3361 | RtcB family protein | - |
EL093_RS17315 | 3536820..3537272 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
EL093_RS17320 | 3537282..3537680 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EL093_RS17325 | 3537683..3537976 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EL093_RS17330 | 3538028..3539083 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
EL093_RS17335 | 3539154..3539939 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
EL093_RS17340 | 3539911..3541623 | + | 1713 | Protein_3367 | flagellar biosynthesis protein FlhA | - |
EL093_RS17345 | 3541847..3542344 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3537282..3553499 | 16217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T287178 WP_001263489.1 NZ_LR134227:c3537680-3537282 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |