Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 732061..732754 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | EL093_RS03585 | Protein ID | WP_000415584.1 |
Coordinates | 732061..732357 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | EL093_RS03590 | Protein ID | WP_000650107.1 |
Coordinates | 732359..732754 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL093_RS03550 | 727149..727463 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
EL093_RS03555 | 727494..728075 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
EL093_RS03560 | 728394..728726 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
EL093_RS03565 | 728772..730121 | - | 1350 | WP_001618857.1 | two-component system sensor histidine kinase QseC | - |
EL093_RS03570 | 730118..730777 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
EL093_RS03575 | 730929..731321 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
EL093_RS03580 | 731374..731856 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
EL093_RS03585 | 732061..732357 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
EL093_RS03590 | 732359..732754 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
EL093_RS03595 | 732887..734494 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
EL093_RS03600 | 734632..736890 | + | 2259 | WP_032161229.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T287166 WP_000415584.1 NZ_LR134227:732061-732357 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT287166 WP_000650107.1 NZ_LR134227:732359-732754 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|