Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4530528..4531130 | Replicon | chromosome |
| Accession | NZ_LR134226 | ||
| Organism | Escherichia coli strain NCTC9088 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | EL094_RS21925 | Protein ID | WP_000897305.1 |
| Coordinates | 4530819..4531130 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL094_RS21920 | Protein ID | WP_000356397.1 |
| Coordinates | 4530528..4530818 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL094_RS21895 | 4526454..4527356 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| EL094_RS21900 | 4527353..4527988 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EL094_RS21905 | 4527985..4528914 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| EL094_RS21910 | 4529244..4529486 | - | 243 | WP_001086388.1 | hypothetical protein | - |
| EL094_RS21915 | 4529705..4529923 | - | 219 | WP_001297075.1 | ribbon-helix-helix domain-containing protein | - |
| EL094_RS21920 | 4530528..4530818 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL094_RS21925 | 4530819..4531130 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| EL094_RS21930 | 4531359..4532267 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| EL094_RS21935 | 4532331..4533272 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
| EL094_RS21940 | 4533317..4533754 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EL094_RS21945 | 4533751..4534623 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EL094_RS21950 | 4534617..4535216 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| EL094_RS21955 | 4535315..4536100 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T287162 WP_000897305.1 NZ_LR134226:c4531130-4530819 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|