Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 593677..594476 | Replicon | chromosome |
| Accession | NZ_LR134226 | ||
| Organism | Escherichia coli strain NCTC9088 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | EL094_RS02955 | Protein ID | WP_126322044.1 |
| Coordinates | 593677..594141 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | EL094_RS02960 | Protein ID | WP_001307405.1 |
| Coordinates | 594141..594476 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL094_RS02925 | 588678..589112 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
| EL094_RS02930 | 589130..590008 | - | 879 | WP_001298758.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| EL094_RS02935 | 589998..590777 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| EL094_RS02940 | 590788..591261 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| EL094_RS02945 | 591284..592564 | - | 1281 | WP_000681922.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| EL094_RS02950 | 592813..593622 | + | 810 | WP_000072193.1 | aga operon transcriptional regulator AgaR | - |
| EL094_RS02955 | 593677..594141 | - | 465 | WP_126322044.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| EL094_RS02960 | 594141..594476 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| EL094_RS02965 | 594625..596196 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| EL094_RS02970 | 596571..597905 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| EL094_RS02975 | 597921..598691 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 593677..605352 | 11675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17823.21 Da Isoelectric Point: 9.4947
>T287147 WP_126322044.1 NZ_LR134226:c594141-593677 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHLPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHLPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|