Detailed information of TA system TA287134

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2717740..2717960
• Replicon: chromosome
• Accession: NZ_LR134222
• Organism: Escherichia coli strain NCTC11129

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A8S7XT81
• Locus tag: EL113_RS13440
• Protein ID: WP_074147554.1
• Coordinates: 2717853..2717960 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2717740..2717806 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EL113_RS13415	2713019..2714413	-	1395	WP_000086201.1	inverse autotransporter invasin YchO	-
EL113_RS13420	2714598..2714951	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
EL113_RS13425	2714995..2715690	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
EL113_RS13430	2715848..2716078	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
EL113_RS13435	2716348..2717448	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2717740..2717806	-	67	-	-	Antitoxin
EL113_RS13440	2717853..2717960	+	108	WP_074147554.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2718273..2718336	-	64	NuclAT_34	-	-
-	2718273..2718336	-	64	NuclAT_34	-	-
-	2718273..2718336	-	64	NuclAT_34	-	-
-	2718273..2718336	-	64	NuclAT_34	-	-
-	2718273..2718336	-	64	NuclAT_36	-	-
-	2718273..2718336	-	64	NuclAT_36	-	-
-	2718273..2718336	-	64	NuclAT_36	-	-
-	2718273..2718336	-	64	NuclAT_36	-	-
-	2718273..2718336	-	64	NuclAT_38	-	-
-	2718273..2718336	-	64	NuclAT_38	-	-
-	2718273..2718336	-	64	NuclAT_38	-	-
-	2718273..2718336	-	64	NuclAT_38	-	-
-	2718273..2718336	-	64	NuclAT_40	-	-
-	2718273..2718336	-	64	NuclAT_40	-	-
-	2718273..2718336	-	64	NuclAT_40	-	-
-	2718273..2718336	-	64	NuclAT_40	-	-
-	2718273..2718336	-	64	NuclAT_42	-	-
-	2718273..2718336	-	64	NuclAT_42	-	-
-	2718273..2718336	-	64	NuclAT_42	-	-
-	2718273..2718336	-	64	NuclAT_42	-	-
-	2718273..2718336	-	64	NuclAT_44	-	-
-	2718273..2718336	-	64	NuclAT_44	-	-
-	2718273..2718336	-	64	NuclAT_44	-	-
-	2718273..2718336	-	64	NuclAT_44	-	-
-	2718274..2718336	-	63	NuclAT_46	-	-
-	2718274..2718336	-	63	NuclAT_46	-	-
-	2718274..2718336	-	63	NuclAT_46	-	-
-	2718274..2718336	-	63	NuclAT_46	-	-
-	2718274..2718336	-	63	NuclAT_49	-	-
-	2718274..2718336	-	63	NuclAT_49	-	-
-	2718274..2718336	-	63	NuclAT_49	-	-
-	2718274..2718336	-	63	NuclAT_49	-	-
-	2718275..2718336	-	62	NuclAT_16	-	-
-	2718275..2718336	-	62	NuclAT_16	-	-
-	2718275..2718336	-	62	NuclAT_16	-	-
-	2718275..2718336	-	62	NuclAT_16	-	-
-	2718275..2718336	-	62	NuclAT_19	-	-
-	2718275..2718336	-	62	NuclAT_19	-	-
-	2718275..2718336	-	62	NuclAT_19	-	-
-	2718275..2718336	-	62	NuclAT_19	-	-
-	2718275..2718336	-	62	NuclAT_22	-	-
-	2718275..2718336	-	62	NuclAT_22	-	-
-	2718275..2718336	-	62	NuclAT_22	-	-
-	2718275..2718336	-	62	NuclAT_22	-	-
-	2718275..2718336	-	62	NuclAT_25	-	-
-	2718275..2718336	-	62	NuclAT_25	-	-
-	2718275..2718336	-	62	NuclAT_25	-	-
-	2718275..2718336	-	62	NuclAT_25	-	-
-	2718275..2718336	-	62	NuclAT_28	-	-
-	2718275..2718336	-	62	NuclAT_28	-	-
-	2718275..2718336	-	62	NuclAT_28	-	-
-	2718275..2718336	-	62	NuclAT_28	-	-
-	2718275..2718336	-	62	NuclAT_31	-	-
-	2718275..2718336	-	62	NuclAT_31	-	-
-	2718275..2718336	-	62	NuclAT_31	-	-
-	2718275..2718336	-	62	NuclAT_31	-	-
EL113_RS13445	2718389..2718496	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2718810..2718876	-	67	NuclAT_45	-	-
-	2718810..2718876	-	67	NuclAT_45	-	-
-	2718810..2718876	-	67	NuclAT_45	-	-
-	2718810..2718876	-	67	NuclAT_45	-	-
-	2718810..2718876	-	67	NuclAT_48	-	-
-	2718810..2718876	-	67	NuclAT_48	-	-
-	2718810..2718876	-	67	NuclAT_48	-	-
-	2718810..2718876	-	67	NuclAT_48	-	-
-	2718811..2718874	-	64	NuclAT_17	-	-
-	2718811..2718874	-	64	NuclAT_17	-	-
-	2718811..2718874	-	64	NuclAT_17	-	-
-	2718811..2718874	-	64	NuclAT_17	-	-
-	2718811..2718874	-	64	NuclAT_20	-	-
-	2718811..2718874	-	64	NuclAT_20	-	-
-	2718811..2718874	-	64	NuclAT_20	-	-
-	2718811..2718874	-	64	NuclAT_20	-	-
-	2718811..2718874	-	64	NuclAT_23	-	-
-	2718811..2718874	-	64	NuclAT_23	-	-
-	2718811..2718874	-	64	NuclAT_23	-	-
-	2718811..2718874	-	64	NuclAT_23	-	-
-	2718811..2718874	-	64	NuclAT_26	-	-
-	2718811..2718874	-	64	NuclAT_26	-	-
-	2718811..2718874	-	64	NuclAT_26	-	-
-	2718811..2718874	-	64	NuclAT_26	-	-
-	2718811..2718874	-	64	NuclAT_29	-	-
-	2718811..2718874	-	64	NuclAT_29	-	-
-	2718811..2718874	-	64	NuclAT_29	-	-
-	2718811..2718874	-	64	NuclAT_29	-	-
-	2718811..2718874	-	64	NuclAT_32	-	-
-	2718811..2718874	-	64	NuclAT_32	-	-
-	2718811..2718874	-	64	NuclAT_32	-	-
-	2718811..2718874	-	64	NuclAT_32	-	-
EL113_RS13450	2718924..2719031	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
EL113_RS13455	2719180..2720034	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
EL113_RS13460	2720070..2720879	-	810	WP_001257044.1	invasion regulator SirB1	-
EL113_RS13465	2720883..2721275	-	393	WP_000200378.1	invasion regulator SirB2	-
EL113_RS13470	2721272..2722105	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T287134 WP_074147554.1 NZ_LR134222:2717853-2717960 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT287134 NZ_LR134222:c2717806-2717740 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin