Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3702907..3703601 | Replicon | chromosome |
Accession | NZ_LR134220 | ||
Organism | Escherichia coli strain NCTC11121 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | EL088_RS18225 | Protein ID | WP_001263493.1 |
Coordinates | 3702907..3703305 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | EL088_RS18230 | Protein ID | WP_000554757.1 |
Coordinates | 3703308..3703601 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 3698566..3698646 | - | 81 | NuclAT_8 | - | - |
- | 3698566..3698646 | - | 81 | NuclAT_8 | - | - |
- | 3698566..3698646 | - | 81 | NuclAT_8 | - | - |
- | 3698566..3698646 | - | 81 | NuclAT_8 | - | - |
EL088_RS18200 | 3699242..3699700 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
EL088_RS18205 | 3699961..3701418 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
EL088_RS18210 | 3701475..3701996 | - | 522 | Protein_3542 | peptide chain release factor H | - |
EL088_RS18215 | 3701995..3702198 | - | 204 | Protein_3543 | RNA ligase RtcB family protein | - |
EL088_RS18220 | 3702445..3702897 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
EL088_RS18225 | 3702907..3703305 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EL088_RS18230 | 3703308..3703601 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EL088_RS18235 | 3703653..3704708 | - | 1056 | WP_111724751.1 | DNA polymerase IV | - |
EL088_RS18240 | 3704779..3705564 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
EL088_RS18245 | 3705536..3707248 | + | 1713 | Protein_3549 | flagellar biosynthesis protein FlhA | - |
EL088_RS18250 | 3707464..3707961 | - | 498 | WP_000006256.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T287119 WP_001263493.1 NZ_LR134220:c3703305-3702907 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|