Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3593058..3593752 | Replicon | chromosome |
Accession | NZ_LR134216 | ||
Organism | Escherichia coli strain NCTC10973 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | EL103_RS17420 | Protein ID | WP_001263489.1 |
Coordinates | 3593058..3593456 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | EL103_RS17425 | Protein ID | WP_000554758.1 |
Coordinates | 3593459..3593752 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 3588646..3588726 | - | 81 | NuclAT_11 | - | - |
- | 3588646..3588726 | - | 81 | NuclAT_11 | - | - |
- | 3588646..3588726 | - | 81 | NuclAT_11 | - | - |
- | 3588646..3588726 | - | 81 | NuclAT_11 | - | - |
EL103_RS17395 | 3589322..3589780 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
EL103_RS17400 | 3590041..3591498 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
EL103_RS17405 | 3591555..3592076 | - | 522 | Protein_3384 | peptide chain release factor H | - |
EL103_RS17410 | 3592072..3592278 | - | 207 | Protein_3385 | RtcB family protein | - |
EL103_RS17415 | 3592596..3593048 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
EL103_RS17420 | 3593058..3593456 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EL103_RS17425 | 3593459..3593752 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EL103_RS17430 | 3593804..3594859 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
EL103_RS17435 | 3594930..3595853 | - | 924 | WP_001232546.1 | putative lateral flagellar export/assembly protein LafU | - |
EL103_RS17440 | 3595856..3596719 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
EL103_RS17445 | 3596732..3597448 | - | 717 | WP_000938723.1 | FliA/WhiG family RNA polymerase sigma factor | - |
EL103_RS17450 | 3597468..3597935 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T287100 WP_001263489.1 NZ_LR134216:c3593456-3593058 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |