Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 711409..712102 | Replicon | chromosome |
Accession | NZ_LR134216 | ||
Organism | Escherichia coli strain NCTC10973 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | EL103_RS03460 | Protein ID | WP_000415584.1 |
Coordinates | 711409..711705 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | EL103_RS03465 | Protein ID | WP_000650107.1 |
Coordinates | 711707..712102 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL103_RS03425 | 706497..706811 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
EL103_RS03430 | 706842..707423 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
EL103_RS03435 | 707742..708074 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
EL103_RS03440 | 708120..709469 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
EL103_RS03445 | 709466..710125 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
EL103_RS03450 | 710277..710669 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
EL103_RS03455 | 710722..711204 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
EL103_RS03460 | 711409..711705 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
EL103_RS03465 | 711707..712102 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
EL103_RS03470 | 712235..713842 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
EL103_RS03475 | 713980..716238 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T287089 WP_000415584.1 NZ_LR134216:711409-711705 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT287089 WP_000650107.1 NZ_LR134216:711707-712102 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|