Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 80176..80897 | Replicon | chromosome |
| Accession | NZ_LR134215 | ||
| Organism | Shimwellia blattae strain NCTC12127 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2B3V7 |
| Locus tag | EL083_RS00345 | Protein ID | WP_002440752.1 |
| Coordinates | 80176..80487 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL083_RS00350 | Protein ID | WP_002440751.1 |
| Coordinates | 80484..80897 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL083_RS00320 | 77004..77834 | + | 831 | WP_002440759.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
| EL083_RS00325 | 78127..78339 | + | 213 | WP_002440757.1 | DUF1471 domain-containing protein | - |
| EL083_RS00330 | 78381..78704 | - | 324 | WP_002440756.1 | AzlD domain-containing protein | - |
| EL083_RS00335 | 78704..79366 | - | 663 | WP_002440754.1 | AzlC family ABC transporter permease | - |
| EL083_RS00340 | 79505..80053 | + | 549 | WP_002440753.1 | XRE family transcriptional regulator | - |
| EL083_RS00345 | 80176..80487 | + | 312 | WP_002440752.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| EL083_RS00350 | 80484..80897 | + | 414 | WP_002440751.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL083_RS00355 | 80956..81270 | - | 315 | WP_034920130.1 | L-rhamnose mutarotase | - |
| EL083_RS00360 | 81282..82430 | - | 1149 | WP_002440748.1 | lactaldehyde reductase | - |
| EL083_RS00365 | 82456..83280 | - | 825 | WP_002440747.1 | rhamnulose-1-phosphate aldolase | - |
| EL083_RS00370 | 83340..84599 | - | 1260 | WP_002440746.1 | L-rhamnose isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.31 Da Isoelectric Point: 9.9315
>T287070 WP_002440752.1 NZ_LR134215:80176-80487 [Shimwellia blattae]
MHIISRAPFDTATKIFPNQAAALDDLYRVLKRENYRSPDEMRMQFPSLDRMKLREKWWVIDVGGGQLRVMFFADFERGKL
FIKHISTHAEYDKLTDYYRRNKE
MHIISRAPFDTATKIFPNQAAALDDLYRVLKRENYRSPDEMRMQFPSLDRMKLREKWWVIDVGGGQLRVMFFADFERGKL
FIKHISTHAEYDKLTDYYRRNKE
Download Length: 312 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15337.62 Da Isoelectric Point: 5.2376
>AT287070 WP_002440751.1 NZ_LR134215:80484-80897 [Shimwellia blattae]
VSYAEAIKTAQALATMFPLLGGSTSRKDYEDALRMVEYLVEHEPDSPLIDMLAARIEKYEDEAPEFAEFNARIASVPAGV
SVLRVIMDQYHLTQSDFEQEIGKKSLVSRILSGQRSLTLAHIKALAARFHIKPELFL
VSYAEAIKTAQALATMFPLLGGSTSRKDYEDALRMVEYLVEHEPDSPLIDMLAARIEKYEDEAPEFAEFNARIASVPAGV
SVLRVIMDQYHLTQSDFEQEIGKKSLVSRILSGQRSLTLAHIKALAARFHIKPELFL
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|