Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4267199..4267722 | Replicon | chromosome |
| Accession | NZ_LR134214 | ||
| Organism | Citrobacter portucalensis strain NCTC11104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL073_RS20955 | Protein ID | WP_126319889.1 |
| Coordinates | 4267576..4267722 (-) | Length | 49 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL073_RS20950 | Protein ID | WP_126319500.1 |
| Coordinates | 4267199..4267555 (-) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL073_RS20920 | 4262668..4263426 | + | 759 | WP_126319494.1 | phosphonate C-P lyase system protein PhnK | - |
| EL073_RS20925 | 4263596..4264282 | + | 687 | WP_063941249.1 | phosphonate C-P lyase system protein PhnL | - |
| EL073_RS20930 | 4264279..4265415 | + | 1137 | WP_126319496.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
| EL073_RS20935 | 4265418..4265972 | + | 555 | WP_008786953.1 | ribose 1,5-bisphosphokinase | - |
| EL073_RS20940 | 4265959..4266393 | + | 435 | WP_126319498.1 | aminoalkylphosphonate N-acetyltransferase | - |
| EL073_RS20945 | 4266402..4267160 | + | 759 | WP_126319499.1 | phosphonate metabolism protein PhnP | - |
| EL073_RS20950 | 4267199..4267555 | - | 357 | WP_126319500.1 | HigA family addiction module antidote protein | Antitoxin |
| EL073_RS20955 | 4267576..4267722 | - | 147 | WP_126319889.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL073_RS20960 | 4267755..4268452 | + | 698 | Protein_4002 | IS1 family transposase | - |
| EL073_RS20965 | 4268446..4268655 | - | 210 | WP_126319501.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EL073_RS20970 | 4268811..4269140 | - | 330 | WP_003031807.1 | hypothetical protein | - |
| EL073_RS20975 | 4269210..4271474 | - | 2265 | WP_126319502.1 | hybrid sensor histidine kinase/response regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 49 a.a. Molecular weight: 5626.45 Da Isoelectric Point: 8.4545
>T287068 WP_126319889.1 NZ_LR134214:c4267722-4267576 [Citrobacter portucalensis]
ISKLAASPEELTGKLQEYSSIRVNKQYRLIFKWINGKAEDVYLDPHIY
ISKLAASPEELTGKLQEYSSIRVNKQYRLIFKWINGKAEDVYLDPHIY
Download Length: 147 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13615.66 Da Isoelectric Point: 7.1670
>AT287068 WP_126319500.1 NZ_LR134214:c4267555-4267199 [Citrobacter portucalensis]
MKQASRKPTTVGDILQYEYLEPLDLKINDLAEILHVHRNTVSALVNNNRKLTTDMAFRLAKAFDTSVDFWRNLQAAVDLW
EVENDMRAQEELNRIVSVKDFIAQRDVGAKKSRLIICL
MKQASRKPTTVGDILQYEYLEPLDLKINDLAEILHVHRNTVSALVNNNRKLTTDMAFRLAKAFDTSVDFWRNLQAAVDLW
EVENDMRAQEELNRIVSVKDFIAQRDVGAKKSRLIICL
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|