Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4267199..4267722 Replicon chromosome
Accession NZ_LR134214
Organism Citrobacter portucalensis strain NCTC11104

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag EL073_RS20955 Protein ID WP_126319889.1
Coordinates 4267576..4267722 (-) Length 49 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag EL073_RS20950 Protein ID WP_126319500.1
Coordinates 4267199..4267555 (-) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL073_RS20920 4262668..4263426 + 759 WP_126319494.1 phosphonate C-P lyase system protein PhnK -
EL073_RS20925 4263596..4264282 + 687 WP_063941249.1 phosphonate C-P lyase system protein PhnL -
EL073_RS20930 4264279..4265415 + 1137 WP_126319496.1 alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase -
EL073_RS20935 4265418..4265972 + 555 WP_008786953.1 ribose 1,5-bisphosphokinase -
EL073_RS20940 4265959..4266393 + 435 WP_126319498.1 aminoalkylphosphonate N-acetyltransferase -
EL073_RS20945 4266402..4267160 + 759 WP_126319499.1 phosphonate metabolism protein PhnP -
EL073_RS20950 4267199..4267555 - 357 WP_126319500.1 HigA family addiction module antidote protein Antitoxin
EL073_RS20955 4267576..4267722 - 147 WP_126319889.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL073_RS20960 4267755..4268452 + 698 Protein_4002 IS1 family transposase -
EL073_RS20965 4268446..4268655 - 210 WP_126319501.1 type II toxin-antitoxin system RelE/ParE family toxin -
EL073_RS20970 4268811..4269140 - 330 WP_003031807.1 hypothetical protein -
EL073_RS20975 4269210..4271474 - 2265 WP_126319502.1 hybrid sensor histidine kinase/response regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(9-47)

Antitoxin

Cro/C1-type helix-turn-helix domain

(18-69)


Sequences

Toxin        


Download         Length: 49 a.a.        Molecular weight: 5626.45 Da        Isoelectric Point: 8.4545

>T287068 WP_126319889.1 NZ_LR134214:c4267722-4267576 [Citrobacter portucalensis]
ISKLAASPEELTGKLQEYSSIRVNKQYRLIFKWINGKAEDVYLDPHIY

Download         Length: 147 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 13615.66 Da        Isoelectric Point: 7.1670

>AT287068 WP_126319500.1 NZ_LR134214:c4267555-4267199 [Citrobacter portucalensis]
MKQASRKPTTVGDILQYEYLEPLDLKINDLAEILHVHRNTVSALVNNNRKLTTDMAFRLAKAFDTSVDFWRNLQAAVDLW
EVENDMRAQEELNRIVSVKDFIAQRDVGAKKSRLIICL

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References