Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2368671..2369233 | Replicon | chromosome |
Accession | NZ_LR134214 | ||
Organism | Citrobacter portucalensis strain NCTC11104 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1C0NXV4 |
Locus tag | EL073_RS11720 | Protein ID | WP_003833016.1 |
Coordinates | 2368955..2369233 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6H3AUF8 |
Locus tag | EL073_RS11715 | Protein ID | WP_003833018.1 |
Coordinates | 2368671..2368955 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL073_RS11700 | 2366366..2367250 | + | 885 | WP_003833024.1 | formate dehydrogenase N subunit beta | - |
EL073_RS11705 | 2367243..2367899 | + | 657 | WP_003020054.1 | formate dehydrogenase-N subunit gamma | - |
EL073_RS11710 | 2368029..2368631 | + | 603 | WP_003833020.1 | inorganic diphosphatase | - |
EL073_RS11715 | 2368671..2368955 | - | 285 | WP_003833018.1 | HigA family addiction module antidote protein | Antitoxin |
EL073_RS11720 | 2368955..2369233 | - | 279 | WP_003833016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL073_RS11725 | 2369454..2371169 | - | 1716 | WP_126318076.1 | ATP-binding cassette domain-containing protein | - |
EL073_RS11730 | 2371479..2373176 | - | 1698 | WP_003833011.1 | malate dehydrogenase | - |
EL073_RS11735 | 2373356..2373496 | - | 141 | WP_003833009.1 | stationary-phase-induced ribosome-associated protein | - |
EL073_RS11740 | 2373724..2374155 | + | 432 | WP_003833007.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10667.30 Da Isoelectric Point: 9.8965
>T287065 WP_003833016.1 NZ_LR134214:c2369233-2368955 [Citrobacter portucalensis]
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C0NXV4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AUF8 |