Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4611614..4612216 | Replicon | chromosome |
Accession | NZ_LR134209 | ||
Organism | Escherichia coli strain NCTC11476 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EL080_RS22255 | Protein ID | WP_000897305.1 |
Coordinates | 4611905..4612216 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL080_RS22250 | Protein ID | WP_000356397.1 |
Coordinates | 4611614..4611904 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL080_RS22225 | 4607540..4608442 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
EL080_RS22230 | 4608439..4609074 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL080_RS22235 | 4609071..4610000 | + | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
EL080_RS22240 | 4610330..4610572 | - | 243 | WP_001087409.1 | hypothetical protein | - |
EL080_RS22245 | 4610791..4611009 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EL080_RS22250 | 4611614..4611904 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL080_RS22255 | 4611905..4612216 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EL080_RS22260 | 4612445..4613353 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
EL080_RS22265 | 4613417..4614358 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
EL080_RS22270 | 4614403..4614840 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL080_RS22275 | 4614837..4615709 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
EL080_RS22280 | 4615703..4616302 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T287044 WP_000897305.1 NZ_LR134209:c4612216-4611905 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|