Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1580232..1580893 | Replicon | chromosome |
| Accession | NZ_LR134201 | ||
| Organism | Cedecea lapagei strain NCTC11466 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL098_RS07635 | Protein ID | WP_126355688.1 |
| Coordinates | 1580232..1580606 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL098_RS07640 | Protein ID | WP_126355689.1 |
| Coordinates | 1580591..1580893 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL098_RS07615 | 1575806..1576864 | + | 1059 | WP_126355685.1 | FUSC family protein | - |
| EL098_RS07620 | 1577038..1577373 | + | 336 | WP_008455006.1 | DUF496 family protein | - |
| EL098_RS07625 | 1577415..1577723 | - | 309 | WP_126355686.1 | helix-turn-helix domain-containing protein | - |
| EL098_RS07630 | 1577916..1580018 | + | 2103 | WP_126355687.1 | elongation factor G | - |
| EL098_RS07635 | 1580232..1580606 | + | 375 | WP_126355688.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL098_RS07640 | 1580591..1580893 | + | 303 | WP_126355689.1 | XRE family transcriptional regulator | Antitoxin |
| EL098_RS07645 | 1580927..1581301 | - | 375 | WP_126355690.1 | DUF4440 domain-containing protein | - |
| EL098_RS07650 | 1581305..1582681 | - | 1377 | WP_126355691.1 | MFS transporter | - |
| EL098_RS07655 | 1582792..1583691 | + | 900 | WP_126355692.1 | LysR family transcriptional regulator | - |
| EL098_RS07660 | 1583708..1585234 | - | 1527 | WP_126355693.1 | cytosine permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14341.61 Da Isoelectric Point: 8.6997
>T287018 WP_126355688.1 NZ_LR134201:1580232-1580606 [Cedecea lapagei]
MWSIKMTDTFDAWFTASDDATKACVIASMVLLKSRGPLLSRPYADTVRGSQYANMKELRVQCKGEPLRLFFAFDIRRYAI
LLCAGNKVGNEKRFYDLMIPRADKEFAAHLKQLTEKEQTEWVEH
MWSIKMTDTFDAWFTASDDATKACVIASMVLLKSRGPLLSRPYADTVRGSQYANMKELRVQCKGEPLRLFFAFDIRRYAI
LLCAGNKVGNEKRFYDLMIPRADKEFAAHLKQLTEKEQTEWVEH
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|