Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2514375..2514559 | Replicon | chromosome |
Accession | NZ_LR134193 | ||
Organism | Staphylococcus aureus strain NCTC13616 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | EL036_RS13005 | Protein ID | WP_000482647.1 |
Coordinates | 2514452..2514559 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2514375..2514435 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL036_RS12995 | 2510171..2511904 | - | 1734 | WP_000486501.1 | ABC transporter ATP-binding protein/permease | - |
EL036_RS13000 | 2511929..2513692 | - | 1764 | WP_001064811.1 | ABC transporter ATP-binding protein/permease | - |
- | 2514375..2514435 | + | 61 | - | - | Antitoxin |
EL036_RS13005 | 2514452..2514559 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EL036_RS13010 | 2514693..2515079 | - | 387 | WP_000779356.1 | flippase GtxA | - |
EL036_RS13015 | 2515347..2516489 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
EL036_RS13020 | 2516549..2517208 | + | 660 | WP_000831298.1 | membrane protein | - |
EL036_RS13025 | 2517387..2518598 | + | 1212 | WP_001191976.1 | multidrug effflux MFS transporter | - |
EL036_RS13030 | 2518721..2519194 | - | 474 | WP_000456498.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T286989 WP_000482647.1 NZ_LR134193:c2514559-2514452 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286989 NZ_LR134193:2514375-2514435 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|