Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF2/- |
| Location | 2048014..2048313 | Replicon | chromosome |
| Accession | NZ_LR134193 | ||
| Organism | Staphylococcus aureus strain NCTC13616 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | EL036_RS10415 | Protein ID | WP_011447039.1 |
| Coordinates | 2048137..2048313 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 2048014..2048069 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL036_RS10370 | 2043345..2043605 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| EL036_RS10375 | 2043658..2044008 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| EL036_RS10380 | 2044693..2045142 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| EL036_RS10385 | 2045237..2045572 | - | 336 | Protein_1932 | SH3 domain-containing protein | - |
| EL036_RS10395 | 2046222..2046713 | - | 492 | WP_000919349.1 | staphylokinase | - |
| EL036_RS10400 | 2046904..2047659 | - | 756 | WP_000861039.1 | CHAP domain-containing protein | - |
| EL036_RS10405 | 2047671..2047925 | - | 255 | WP_000611512.1 | phage holin | - |
| EL036_RS10410 | 2047977..2048084 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2048006..2048145 | + | 140 | NuclAT_1 | - | - |
| - | 2048006..2048145 | + | 140 | NuclAT_1 | - | - |
| - | 2048006..2048145 | + | 140 | NuclAT_1 | - | - |
| - | 2048006..2048145 | + | 140 | NuclAT_1 | - | - |
| - | 2048014..2048069 | + | 56 | - | - | Antitoxin |
| EL036_RS10415 | 2048137..2048313 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| EL036_RS10420 | 2048463..2048759 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| EL036_RS10425 | 2048817..2049104 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| EL036_RS10430 | 2049151..2049303 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| EL036_RS10435 | 2049293..2053078 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2043658..2101579 | 57921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286983 WP_011447039.1 NZ_LR134193:c2048313-2048137 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286983 NZ_LR134193:2048014-2048069 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|