Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1894974..1895154 | Replicon | chromosome |
| Accession | NZ_LR134193 | ||
| Organism | Staphylococcus aureus strain NCTC13616 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EL036_RS09400 | Protein ID | WP_001801861.1 |
| Coordinates | 1894974..1895069 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1895097..1895154 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL036_RS09360 | 1890261..1891028 | - | 768 | WP_001095317.1 | IS21-like element helper ATPase IstB | - |
| EL036_RS09365 | 1891040..1892275 | - | 1236 | WP_001215400.1 | IS21 family transposase | - |
| EL036_RS09370 | 1892633..1893202 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EL036_RS09380 | 1893575..1893751 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| EL036_RS09385 | 1893762..1894145 | - | 384 | WP_000070809.1 | hypothetical protein | - |
| EL036_RS09390 | 1894327..1894551 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
| EL036_RS09395 | 1894725..1894829 | - | 105 | WP_001670380.1 | transposase | - |
| EL036_RS09400 | 1894974..1895069 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1895097..1895154 | - | 58 | - | - | Antitoxin |
| EL036_RS09405 | 1895192..1895293 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| EL036_RS09410 | 1895271..1895443 | - | 173 | Protein_1786 | transposase | - |
| EL036_RS09415 | 1895637..1896014 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| EL036_RS09420 | 1896221..1896661 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| EL036_RS09425 | 1896706..1898319 | + | 1614 | WP_000926708.1 | lipase | - |
| EL036_RS09430 | 1898334..1898633 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| EL036_RS09435 | 1898950..1900131 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1865623..1911385 | 45762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286980 WP_001801861.1 NZ_LR134193:1894974-1895069 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T286980 NZ_LR134193:1894974-1895069 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT286980 NZ_LR134193:c1895154-1895097 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|