Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 1524245..1524552 | Replicon | chromosome |
Accession | NZ_LR134193 | ||
Organism | Staphylococcus aureus strain NCTC13616 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EL036_RS07425 | Protein ID | WP_011447039.1 |
Coordinates | 1524376..1524552 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 1524245..1524384 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL036_RS14670 | 1519487..1519702 | - | 216 | WP_170267452.1 | hypothetical protein | - |
EL036_RS07400 | 1519881..1520891 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
EL036_RS07405 | 1520878..1522782 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
EL036_RS07410 | 1523143..1523898 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EL036_RS07415 | 1523910..1524164 | - | 255 | WP_000611512.1 | phage holin | - |
EL036_RS07420 | 1524216..1524323 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1524245..1524384 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1524245..1524384 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1524245..1524384 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1524245..1524384 | + | 140 | NuclAT_0 | - | Antitoxin |
EL036_RS07425 | 1524376..1524552 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EL036_RS07430 | 1524705..1525004 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
EL036_RS07435 | 1525050..1525214 | - | 165 | WP_000916020.1 | XkdX family protein | - |
EL036_RS07440 | 1525207..1525596 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
EL036_RS07445 | 1525596..1527062 | - | 1467 | WP_000067127.1 | BppU family phage baseplate upper protein | - |
EL036_RS07450 | 1527062..1528972 | - | 1911 | WP_000429558.1 | minor structural protein | - |
EL036_RS07455 | 1528988..1529278 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1515948..1580722 | 64774 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286975 WP_011447039.1 NZ_LR134193:c1524552-1524376 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT286975 NZ_LR134193:1524245-1524384 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|