Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1529243..1529968 | Replicon | chromosome |
| Accession | NZ_LR134189 | ||
| Organism | Providencia rustigianii strain NCTC6933 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL059_RS06985 | Protein ID | WP_115164162.1 |
| Coordinates | 1529663..1529968 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL059_RS06980 | Protein ID | WP_006813416.1 |
| Coordinates | 1529243..1529659 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL059_RS06965 | 1525330..1526307 | + | 978 | WP_006813419.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| EL059_RS06970 | 1526446..1528090 | + | 1645 | Protein_1344 | flagellar hook-associated protein FlgK | - |
| EL059_RS06975 | 1528139..1529074 | + | 936 | WP_039854240.1 | flagellar hook-associated protein FlgL | - |
| EL059_RS06980 | 1529243..1529659 | - | 417 | WP_006813416.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL059_RS06985 | 1529663..1529968 | - | 306 | WP_115164162.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| EL059_RS06990 | 1530289..1531069 | - | 781 | Protein_1348 | flagellar type III secretion system protein FliR | - |
| EL059_RS06995 | 1531072..1531341 | - | 270 | WP_006813413.1 | flagellar biosynthesis protein FliQ | - |
| EL059_RS07000 | 1531350..1532093 | - | 744 | WP_006813412.1 | flagellar type III secretion system pore protein FliP | - |
| EL059_RS07005 | 1532106..1532582 | - | 477 | WP_006813411.1 | flagellar biosynthetic protein FliO | - |
| EL059_RS07010 | 1532584..1533000 | - | 417 | Protein_1352 | flagellar motor switch protein FliN | - |
| EL059_RS07015 | 1532993..1534000 | - | 1008 | WP_115164172.1 | flagellar motor switch protein FliM | - |
| EL059_RS07020 | 1534006..1534488 | - | 483 | WP_006813408.1 | flagellar basal body-associated protein FliL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12062.00 Da Isoelectric Point: 10.4596
>T286969 WP_115164162.1 NZ_LR134189:c1529968-1529663 [Providencia rustigianii]
MHVISREPFVHASERNPKHAKALLDVYKTLKQGSYSSPDELKNIFPSLDRMKYREKWWVIDVGGNALRILFFADFKKSKI
FIKHISTHAEYNKLMNYYRRT
MHVISREPFVHASERNPKHAKALLDVYKTLKQGSYSSPDELKNIFPSLDRMKYREKWWVIDVGGNALRILFFADFKKSKI
FIKHISTHAEYNKLMNYYRRT
Download Length: 306 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 16096.38 Da Isoelectric Point: 5.2536
>AT286969 WP_006813416.1 NZ_LR134189:c1529659-1529243 [Providencia rustigianii]
MIFSEAIQTANHLIHLIPILGKNHSRRDYEDAIKLVEYLVEYDPDNPLVEILCEKIDHYEDNAPEFADFNRKLKQCDDAV
AVLRTLMDQYNLNTTDFANEIGSRSYVSRILNGERNLSLEHMKKLAERFKLPVTIFIK
MIFSEAIQTANHLIHLIPILGKNHSRRDYEDAIKLVEYLVEYDPDNPLVEILCEKIDHYEDNAPEFADFNRKLKQCDDAV
AVLRTLMDQYNLNTTDFANEIGSRSYVSRILNGERNLSLEHMKKLAERFKLPVTIFIK
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|