Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 615974..616663 | Replicon | chromosome |
| Accession | NZ_LR134189 | ||
| Organism | Providencia rustigianii strain NCTC6933 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | D1P6V8 |
| Locus tag | EL059_RS02800 | Protein ID | WP_006815972.1 |
| Coordinates | 615974..616294 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL059_RS02805 | Protein ID | WP_039855724.1 |
| Coordinates | 616331..616663 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL059_RS02785 | 611206..612219 | + | 1014 | WP_006815975.1 | mechanosensitive ion channel family protein | - |
| EL059_RS02790 | 612492..614651 | + | 2160 | WP_126436334.1 | ornithine decarboxylase | - |
| EL059_RS02795 | 614751..615686 | + | 936 | WP_006815973.1 | nucleoside hydrolase | - |
| EL059_RS02800 | 615974..616294 | + | 321 | WP_006815972.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL059_RS02805 | 616331..616663 | + | 333 | WP_039855724.1 | HigA family addiction module antidote protein | Antitoxin |
| EL059_RS02810 | 616776..617801 | + | 1026 | WP_112836104.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| EL059_RS18375 | 617903..618076 | + | 174 | WP_006815969.1 | hypothetical protein | - |
| EL059_RS02815 | 618122..619105 | - | 984 | WP_126436336.1 | quinone oxidoreductase | - |
| EL059_RS02820 | 619315..620724 | + | 1410 | WP_006815966.1 | replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12700.77 Da Isoelectric Point: 8.4429
>T286965 WP_006815972.1 NZ_LR134189:615974-616294 [Providencia rustigianii]
MEEVYVNEDNDCRLIFRDEYLRLFYVYGKLHRLIPSIICTVLARKLDMLNAAKTLQDFKSPPGNRFKQLKPPLEEFYSIR
VNGQYRLIFKWKDTVEGLYLDPHKDV
MEEVYVNEDNDCRLIFRDEYLRLFYVYGKLHRLIPSIICTVLARKLDMLNAAKTLQDFKSPPGNRFKQLKPPLEEFYSIR
VNGQYRLIFKWKDTVEGLYLDPHKDV
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|