Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1925232..1925882 | Replicon | chromosome |
Accession | NZ_LR134169 | ||
Organism | Actinobacillus lignieresii strain NCTC10568 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | ELZ64_RS09230 | Protein ID | WP_126375324.1 |
Coordinates | 1925541..1925882 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ELZ64_RS09225 | Protein ID | WP_115587655.1 |
Coordinates | 1925232..1925540 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ64_RS09200 | 1920384..1920953 | - | 570 | WP_115587652.1 | septal ring lytic transglycosylase RlpA family protein | - |
ELZ64_RS09205 | 1921128..1922252 | - | 1125 | WP_126375322.1 | rod shape-determining protein RodA | - |
ELZ64_RS09210 | 1922245..1924205 | - | 1961 | Protein_1784 | penicillin-binding protein 2 | - |
ELZ64_RS09215 | 1924288..1924755 | - | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
ELZ64_RS09220 | 1924777..1925091 | - | 315 | WP_126375531.1 | ribosome silencing factor | - |
ELZ64_RS09225 | 1925232..1925540 | - | 309 | WP_115587655.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
ELZ64_RS09230 | 1925541..1925882 | - | 342 | WP_126375324.1 | toxin | Toxin |
ELZ64_RS09235 | 1926062..1928656 | - | 2595 | WP_126375326.1 | DNA mismatch repair protein MutS | - |
ELZ64_RS09240 | 1928822..1929571 | - | 750 | WP_115587658.1 | amino acid ABC transporter ATP-binding protein | - |
ELZ64_RS09245 | 1929593..1930309 | - | 717 | WP_115587659.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13304.20 Da Isoelectric Point: 9.8649
>T286954 WP_126375324.1 NZ_LR134169:c1925882-1925541 [Actinobacillus lignieresii]
VKLVFVELPPFNKFRYENLTDDDYREFQEYLMNNPEAGDIVQGINGLRKISISTQSRGKKGGARVIYYYYVRGSQIWLFT
GYNKSRKIDLNSMERKAFSKVLEHLKNIADREL
VKLVFVELPPFNKFRYENLTDDDYREFQEYLMNNPEAGDIVQGINGLRKISISTQSRGKKGGARVIYYYYVRGSQIWLFT
GYNKSRKIDLNSMERKAFSKVLEHLKNIADREL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|