Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1583373..1584012 | Replicon | chromosome |
Accession | NZ_LR134168 | ||
Organism | Haemophilus influenzae strain NCTC11394 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B2WM63 |
Locus tag | ELZ62_RS08050 | Protein ID | WP_005694311.1 |
Coordinates | 1583707..1584012 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ELZ62_RS08045 | Protein ID | WP_005650217.1 |
Coordinates | 1583373..1583696 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ62_RS09390 | 1579118..1579291 | - | 174 | WP_005652999.1 | DUF5363 domain-containing protein | - |
ELZ62_RS08030 | 1579288..1581132 | - | 1845 | WP_015702146.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
ELZ62_RS08035 | 1581137..1581478 | - | 342 | WP_005666735.1 | SirB2 family protein | - |
ELZ62_RS08040 | 1581540..1583210 | - | 1671 | WP_015702145.1 | energy-dependent translational throttle protein EttA | - |
ELZ62_RS08045 | 1583373..1583696 | - | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
ELZ62_RS08050 | 1583707..1584012 | - | 306 | WP_005694311.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ELZ62_RS08055 | 1584338..1584958 | + | 621 | WP_005650213.1 | zinc transporter binding subunit ZevA | - |
ELZ62_RS08060 | 1584961..1585929 | + | 969 | WP_015702144.1 | zinc transporter permease subunit ZevB | - |
ELZ62_RS08070 | 1586544..1588583 | + | 2040 | WP_005646675.1 | excinuclease ABC subunit B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12248.89 Da Isoelectric Point: 8.0244
>T286950 WP_005694311.1 NZ_LR134168:c1584012-1583707 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYCL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYCL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|