Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2040168..2040803 | Replicon | chromosome |
| Accession | NZ_LR134167 | ||
| Organism | Avibacterium volantium strain NCTC3438 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | ELZ61_RS09680 | Protein ID | WP_126373258.1 |
| Coordinates | 2040498..2040803 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ELZ61_RS09675 | Protein ID | WP_126373681.1 |
| Coordinates | 2040168..2040488 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ61_RS09645 | 2035601..2036239 | - | 639 | WP_126373250.1 | phosphoribosylglycinamide formyltransferase | - |
| ELZ61_RS09650 | 2036239..2037276 | - | 1038 | WP_126373252.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| ELZ61_RS09655 | 2037509..2037977 | + | 469 | Protein_1863 | hypothetical protein | - |
| ELZ61_RS09660 | 2038087..2038812 | - | 726 | WP_115249505.1 | TerC family protein | - |
| ELZ61_RS09665 | 2038883..2039551 | - | 669 | WP_126373254.1 | DNA mismatch repair endonuclease MutH | - |
| ELZ61_RS09670 | 2039582..2040121 | - | 540 | WP_126373256.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| ELZ61_RS09675 | 2040168..2040488 | - | 321 | WP_126373681.1 | HigA family addiction module antidote protein | Antitoxin |
| ELZ61_RS09680 | 2040498..2040803 | - | 306 | WP_126373258.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ELZ61_RS09685 | 2040945..2042324 | - | 1380 | WP_126373260.1 | OmpP1/FadL family transporter | - |
| ELZ61_RS09690 | 2042575..2044233 | - | 1659 | WP_126373262.1 | putative transporter | - |
| ELZ61_RS09695 | 2044444..2044953 | + | 510 | WP_126373264.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12151.93 Da Isoelectric Point: 9.2219
>T286942 WP_126373258.1 NZ_LR134167:c2040803-2040498 [Avibacterium volantium]
MFNLTAKHFKDDYLYRFFQYGELHSKIPANLTKVLARKLDMINAAENLNDLRVPPANHLELLEPKENKRYSIRVNKQYRL
IFHFDNGELSQLYLDPHRYDL
MFNLTAKHFKDDYLYRFFQYGELHSKIPANLTKVLARKLDMINAAENLNDLRVPPANHLELLEPKENKRYSIRVNKQYRL
IFHFDNGELSQLYLDPHRYDL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|