Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 1554730..1555379 | Replicon | chromosome |
| Accession | NZ_LR134167 | ||
| Organism | Avibacterium volantium strain NCTC3438 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | ELZ61_RS07485 | Protein ID | WP_126372598.1 |
| Coordinates | 1555047..1555379 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ELZ61_RS07480 | Protein ID | WP_126372596.1 |
| Coordinates | 1554730..1555044 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ61_RS07470 | 1550638..1552497 | + | 1860 | WP_126372592.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| ELZ61_RS07475 | 1552683..1554626 | - | 1944 | WP_126372594.1 | ABC transporter ATP-binding protein | - |
| ELZ61_RS07480 | 1554730..1555044 | - | 315 | WP_126372596.1 | helix-turn-helix domain-containing protein | Antitoxin |
| ELZ61_RS07485 | 1555047..1555379 | - | 333 | WP_126372598.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ELZ61_RS07490 | 1555455..1555979 | - | 525 | WP_126372600.1 | gluconokinase | - |
| ELZ61_RS07495 | 1556258..1557607 | + | 1350 | WP_126372602.1 | GntP family permease | - |
| ELZ61_RS07505 | 1558194..1559111 | - | 918 | WP_164550727.1 | mechanosensitive ion channel | - |
| ELZ61_RS07510 | 1559187..1560254 | - | 1068 | WP_126372606.1 | LPS export ABC transporter permease LptG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12787.87 Da Isoelectric Point: 9.7722
>T286939 WP_126372598.1 NZ_LR134167:c1555379-1555047 [Avibacterium volantium]
MKAVFIELPFFEKYRKEYLSDDEYLMLQNELLVTPEKGDLIQGTGGLRKLRIANSKRNRGKRGGARVIYYYYVHNAAIYF
LTAYGKEMKEDLTADEKSILVKIVENIKGK
MKAVFIELPFFEKYRKEYLSDDEYLMLQNELLVTPEKGDLIQGTGGLRKLRIANSKRNRGKRGGARVIYYYYVHNAAIYF
LTAYGKEMKEDLTADEKSILVKIVENIKGK
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|