Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1425935..1426527 | Replicon | chromosome |
| Accession | NZ_LR134167 | ||
| Organism | Avibacterium volantium strain NCTC3438 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | ELZ61_RS06925 | Protein ID | WP_126372430.1 |
| Coordinates | 1426249..1426527 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ELZ61_RS06920 | Protein ID | WP_197717477.1 |
| Coordinates | 1425935..1426234 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ61_RS06890 | 1421015..1422139 | + | 1125 | WP_126372422.1 | bifunctional chorismate mutase/prephenate dehydrogenase | - |
| ELZ61_RS06895 | 1422317..1423228 | + | 912 | WP_126372424.1 | cytidine deaminase | - |
| ELZ61_RS06900 | 1423266..1423814 | - | 549 | WP_115249597.1 | HAD family hydrolase | - |
| ELZ61_RS06905 | 1423819..1424754 | - | 936 | WP_126372426.1 | KpsF/GutQ family sugar isomerase | - |
| ELZ61_RS06915 | 1425329..1425778 | - | 450 | WP_126372428.1 | macrodomain Ter protein MatP | - |
| ELZ61_RS06920 | 1425935..1426234 | - | 300 | WP_197717477.1 | HigA family addiction module antidote protein | Antitoxin |
| ELZ61_RS06925 | 1426249..1426527 | - | 279 | WP_126372430.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ELZ61_RS06930 | 1426663..1428435 | + | 1773 | WP_126372433.1 | Lon protease family protein | - |
| ELZ61_RS06935 | 1428565..1429218 | - | 654 | WP_021724593.1 | IS1595 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1428565..1429218 | 653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10864.49 Da Isoelectric Point: 9.1907
>T286938 WP_126372430.1 NZ_LR134167:c1426527-1426249 [Avibacterium volantium]
MITHFSCKETQAFFEGKRIRRFIPFEKVAMRKLQQLNAATELNFLKIPPGNHLEQLSGDRKGQYSIRINDQWRICFTWLN
GHAADVEIVDYH
MITHFSCKETQAFFEGKRIRRFIPFEKVAMRKLQQLNAATELNFLKIPPGNHLEQLSGDRKGQYSIRINDQWRICFTWLN
GHAADVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|