Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4469347..4469949 | Replicon | chromosome |
Accession | NZ_LR134164 | ||
Organism | Enterobacter hormaechei strain NCTC11571 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A155DUZ6 |
Locus tag | EL051_RS21400 | Protein ID | WP_022649837.1 |
Coordinates | 4469638..4469949 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL051_RS21395 | Protein ID | WP_032626927.1 |
Coordinates | 4469347..4469637 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL051_RS21380 | 4466845..4467747 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
EL051_RS21385 | 4467744..4468379 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL051_RS21390 | 4468376..4469305 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
EL051_RS21395 | 4469347..4469637 | - | 291 | WP_032626927.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL051_RS21400 | 4469638..4469949 | - | 312 | WP_022649837.1 | hypothetical protein | Toxin |
EL051_RS21405 | 4470098..4471039 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
EL051_RS21410 | 4471084..4471521 | - | 438 | WP_063150747.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL051_RS21415 | 4471518..4472400 | - | 883 | Protein_4115 | virulence factor BrkB family protein | - |
EL051_RS21420 | 4472394..4472993 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
EL051_RS21425 | 4473112..4473912 | - | 801 | WP_023298924.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
EL051_RS21430 | 4473947..4474843 | - | 897 | WP_038416951.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12148.13 Da Isoelectric Point: 9.4455
>T286934 WP_022649837.1 NZ_LR134164:c4469949-4469638 [Enterobacter hormaechei]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|