Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 95828..96474 | Replicon | chromosome |
| Accession | NZ_LR134164 | ||
| Organism | Enterobacter hormaechei strain NCTC11571 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL051_RS00480 | Protein ID | WP_047050720.1 |
| Coordinates | 96124..96474 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A9E7BLR3 |
| Locus tag | EL051_RS00475 | Protein ID | WP_023299004.1 |
| Coordinates | 95828..96127 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL051_RS00450 | 91296..91880 | - | 585 | WP_023299002.1 | type 1 fimbrial protein | - |
| EL051_RS00455 | 91933..92535 | - | 603 | WP_045308231.1 | LuxR C-terminal-related transcriptional regulator | - |
| EL051_RS00460 | 93370..94158 | + | 789 | WP_126291583.1 | winged helix-turn-helix domain-containing protein | - |
| EL051_RS00465 | 94160..94639 | + | 480 | WP_126314416.1 | hypothetical protein | - |
| EL051_RS00470 | 94882..95763 | + | 882 | WP_032622044.1 | helix-turn-helix domain-containing protein | - |
| EL051_RS00475 | 95828..96127 | - | 300 | WP_023299004.1 | XRE family transcriptional regulator | Antitoxin |
| EL051_RS00480 | 96124..96474 | - | 351 | WP_047050720.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL051_RS00485 | 96629..97044 | - | 416 | Protein_95 | hydroxyacid dehydrogenase | - |
| EL051_RS00490 | 97095..97436 | - | 342 | WP_063163341.1 | SymE family type I addiction module toxin | - |
| EL051_RS00495 | 97573..97749 | + | 177 | WP_126314418.1 | toxin-antitoxin system HicB family antitoxin | - |
| EL051_RS00500 | 98031..99998 | - | 1968 | WP_045897277.1 | RNA-directed DNA polymerase | - |
| EL051_RS00505 | 99999..101252 | - | 1254 | WP_126314420.1 | RNA-directed DNA polymerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 81346..101252 | 19906 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13497.59 Da Isoelectric Point: 8.8416
>T286925 WP_047050720.1 NZ_LR134164:c96474-96124 [Enterobacter hormaechei]
MWTVLFSKVFEQWLLEQEDGLQEKVLADLLNLQNYGPRLPRPYADTVKGSQYKNMKELRIQYAGRPVRAFFAFDPVRQAI
VLCAGDKRNDKTFYEKLIRIADAEFTLHLTSLEAAK
MWTVLFSKVFEQWLLEQEDGLQEKVLADLLNLQNYGPRLPRPYADTVKGSQYKNMKELRIQYAGRPVRAFFAFDPVRQAI
VLCAGDKRNDKTFYEKLIRIADAEFTLHLTSLEAAK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|