Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4250077..4250660 | Replicon | chromosome |
| Accession | NZ_LR134161 | ||
| Organism | Yersinia enterocolitica subsp. enterocolitica strain NCTC13629 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U7FJS5 |
| Locus tag | EL026_RS20035 | Protein ID | WP_005162526.1 |
| Coordinates | 4250077..4250355 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL026_RS20040 | Protein ID | WP_005162529.1 |
| Coordinates | 4250355..4250660 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL026_RS20015 | 4245558..4246505 | - | 948 | WP_005162520.1 | trehalose operon repressor TreR | - |
| EL026_RS20030 | 4247277..4249997 | + | 2721 | WP_005162523.1 | magnesium-translocating P-type ATPase | - |
| EL026_RS20035 | 4250077..4250355 | + | 279 | WP_005162526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL026_RS20040 | 4250355..4250660 | + | 306 | WP_005162529.1 | HigA family addiction module antidote protein | Antitoxin |
| EL026_RS20045 | 4250732..4252660 | - | 1929 | WP_005162532.1 | BglG family transcription antiterminator | - |
| EL026_RS20050 | 4252733..4253974 | - | 1242 | WP_005162536.1 | lactonase family protein | - |
| EL026_RS20055 | 4254104..4254844 | - | 741 | Protein_3760 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10694.10 Da Isoelectric Point: 7.4011
>T286915 WP_005162526.1 NZ_LR134161:4250077-4250355 [Yersinia enterocolitica subsp. enterocolitica]
MIKSWKHKGLQRFFETGSAAGINPQHVKRIRDRLRFIDLAETIEDVNVAGYKLHPLQGEREGIWSVTVSGNWRITFEFTA
GDAFILNYEDYH
MIKSWKHKGLQRFFETGSAAGINPQHVKRIRDRLRFIDLAETIEDVNVAGYKLHPLQGEREGIWSVTVSGNWRITFEFTA
GDAFILNYEDYH
Download Length: 279 bp
Antitoxin
Download Length: 102 a.a. Molecular weight: 10934.77 Da Isoelectric Point: 6.7158
>AT286915 WP_005162529.1 NZ_LR134161:4250355-4250660 [Yersinia enterocolitica subsp. enterocolitica]
MKMHNPPHPGEMIEGILEDLGLGIREFARALNVSPSTVQRLVACKAAISPEMAVKLAAVLGSTPAMWLRLQAAYDLGKAE
ENVDVSNLTKLYKPDPISLHS
MKMHNPPHPGEMIEGILEDLGLGIREFARALNVSPSTVQRLVACKAAISPEMAVKLAAVLGSTPAMWLRLQAAYDLGKAE
ENVDVSNLTKLYKPDPISLHS
Download Length: 306 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|