Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-RelB
Location 2228257..2228802 Replicon chromosome
Accession NZ_LR134161
Organism Yersinia enterocolitica subsp. enterocolitica strain NCTC13629

Toxin (Protein)


Gene name yafQ Uniprot ID A0A7T9XU23
Locus tag EL026_RS10275 Protein ID WP_005161463.1
Coordinates 2228524..2228802 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A7T9Y052
Locus tag EL026_RS10270 Protein ID WP_005161466.1
Coordinates 2228257..2228517 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL026_RS10235 2223522..2224277 + 756 Protein_1904 IS21 family transposase -
EL026_RS10240 2224264..2224989 + 726 WP_014608996.1 IS21-like element ISYen2A/ISYen2B family helper ATPase IstB -
EL026_RS10245 2225222..2225360 - 139 Protein_1906 ash family protein -
EL026_RS10250 2225652..2226536 - 885 WP_072077259.1 Rpn family recombination-promoting nuclease/putative transposase -
EL026_RS21380 2226742..2226918 - 177 WP_005161476.1 hypothetical protein -
EL026_RS10255 2227360..2227680 - 321 WP_005161473.1 hypothetical protein -
EL026_RS10260 2227670..2227876 - 207 WP_005161471.1 hypothetical protein -
EL026_RS10265 2228018..2228185 + 168 WP_005161469.1 hypothetical protein -
EL026_RS10270 2228257..2228517 + 261 WP_005161466.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL026_RS10275 2228524..2228802 + 279 WP_005161463.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
EL026_RS10280 2228855..2229467 - 613 Protein_1914 tail fiber assembly protein -
EL026_RS10285 2229467..2230630 - 1164 Protein_1915 tail fiber protein -
EL026_RS21485 2230628..2230759 - 132 Protein_1916 phage tail protein -
EL026_RS10290 2230732..2231013 - 282 WP_005161459.1 phage tail protein -
EL026_RS10295 2231010..2231552 - 543 WP_005161456.1 phage tail protein I -
EL026_RS10300 2231545..2232453 - 909 WP_005178623.1 baseplate assembly protein -
EL026_RS10305 2232453..2232809 - 357 WP_005161449.1 GPW/gp25 family protein -
EL026_RS10310 2232806..2233441 - 636 WP_005161446.1 phage baseplate assembly protein V -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - pilW 2220481..2258759 38278


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(4-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 11002.70 Da        Isoelectric Point: 9.6243

>T286909 WP_005161463.1 NZ_LR134161:2228524-2228802 [Yersinia enterocolitica subsp. enterocolitica]
MTKQREIEYSGQFQKDVKKAQKRHKDINKLKTIMALLIDDKLPLPVIYKDHQLQGNYKGYRDAHIEPDWLIIYKITDDLL
RFERTGSHSDLF

Download         Length: 279 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9277.75 Da        Isoelectric Point: 7.0134

>AT286909 WP_005161466.1 NZ_LR134161:2228257-2228517 [Yersinia enterocolitica subsp. enterocolitica]
MAANAFVRARIDETLKNEAAAVLAGMGLTVSDLVRITLTKVAREKALPFDLRIPNELTAKTIANSEKGVDVHKAKDADDL
FDKLGI

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7T9XU23

Antitoxin

Source ID Structure
AlphaFold DB A0A7T9Y052

References