Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3673679..3674325 | Replicon | chromosome |
| Accession | NZ_LR134152 | ||
| Organism | Escherichia coli strain NCTC9104 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | EL040_RS17960 | Protein ID | WP_126350685.1 |
| Coordinates | 3673679..3674029 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | EL040_RS17965 | Protein ID | WP_000554758.1 |
| Coordinates | 3674032..3674325 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3669221..3669301 | - | 81 | NuclAT_11 | - | - |
| - | 3669221..3669301 | - | 81 | NuclAT_11 | - | - |
| - | 3669221..3669301 | - | 81 | NuclAT_11 | - | - |
| - | 3669221..3669301 | - | 81 | NuclAT_11 | - | - |
| EL040_RS17935 | 3669897..3670355 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL040_RS17940 | 3670616..3672073 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| EL040_RS17945 | 3672130..3672651 | - | 522 | Protein_3493 | peptide chain release factor H | - |
| EL040_RS17950 | 3672647..3672853 | - | 207 | Protein_3494 | RtcB family protein | - |
| EL040_RS17955 | 3673170..3673621 | - | 452 | Protein_3495 | GNAT family N-acetyltransferase | - |
| EL040_RS17960 | 3673679..3674029 | - | 351 | WP_126350685.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| EL040_RS17965 | 3674032..3674325 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL040_RS17970 | 3674377..3675432 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL040_RS17975 | 3675503..3676289 | - | 787 | Protein_3499 | putative lateral flagellar export/assembly protein LafU | - |
| EL040_RS17980 | 3676261..3677973 | + | 1713 | Protein_3500 | flagellar biosynthesis protein FlhA | - |
| EL040_RS17985 | 3678197..3678694 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13524.43 Da Isoelectric Point: 6.0794
>T286891 WP_126350685.1 NZ_LR134152:c3674029-3673679 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNN
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNN
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|