Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1988711..1989010 | Replicon | chromosome |
Accession | NZ_LR134139 | ||
Organism | Staphylococcus aureus strain NCTC4163 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | ELZ55_RS10250 | Protein ID | WP_072353918.1 |
Coordinates | 1988834..1989010 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1988711..1988766 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ55_RS10195 | 1984269..1984448 | + | 180 | WP_000669789.1 | hypothetical protein | - |
ELZ55_RS10205 | 1984759..1985019 | + | 261 | WP_001791826.1 | hypothetical protein | - |
ELZ55_RS10210 | 1985072..1985422 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
ELZ55_RS10215 | 1985932..1986267 | - | 336 | Protein_1877 | SH3 domain-containing protein | - |
ELZ55_RS10230 | 1986919..1987410 | - | 492 | WP_000920041.1 | staphylokinase | - |
ELZ55_RS10235 | 1987601..1988356 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ELZ55_RS10240 | 1988368..1988622 | - | 255 | WP_000611512.1 | phage holin | - |
ELZ55_RS10245 | 1988674..1988781 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1988703..1988842 | + | 140 | NuclAT_0 | - | - |
- | 1988703..1988842 | + | 140 | NuclAT_0 | - | - |
- | 1988703..1988842 | + | 140 | NuclAT_0 | - | - |
- | 1988703..1988842 | + | 140 | NuclAT_0 | - | - |
- | 1988711..1988766 | + | 56 | - | - | Antitoxin |
ELZ55_RS10250 | 1988834..1989010 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
ELZ55_RS10255 | 1989153..1989527 | - | 375 | WP_000340977.1 | hypothetical protein | - |
ELZ55_RS10260 | 1989583..1989870 | - | 288 | WP_001262620.1 | hypothetical protein | - |
ELZ55_RS10265 | 1989916..1990068 | - | 153 | WP_001000058.1 | hypothetical protein | - |
ELZ55_RS10270 | 1990061..1993843 | - | 3783 | WP_042727565.1 | phage minor structural protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1985072..2039678 | 54606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T286849 WP_072353918.1 NZ_LR134139:c1989010-1988834 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286849 NZ_LR134139:1988711-1988766 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|