Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2278859..2279568 | Replicon | chromosome |
Accession | NZ_LR134136 | ||
Organism | Atlantibacter hermannii strain NCTC12129 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | H5V274 |
Locus tag | EL032_RS10860 | Protein ID | WP_002435659.1 |
Coordinates | 2279263..2279568 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | H5V273 |
Locus tag | EL032_RS10855 | Protein ID | WP_002435658.1 |
Coordinates | 2278859..2279263 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL032_RS10835 (NCTC12129_02481) | 2274691..2276244 | + | 1554 | WP_170170514.1 | urea ABC transporter permease subunit UrtB | - |
EL032_RS10840 (NCTC12129_02482) | 2276244..2277318 | + | 1075 | Protein_2145 | urea ABC transporter permease subunit UrtC | - |
EL032_RS10845 | 2277318..2278117 | + | 800 | Protein_2146 | urea ABC transporter ATP-binding protein UrtD | - |
EL032_RS10850 (NCTC12129_02484) | 2278127..2278825 | + | 699 | WP_002435657.1 | urea ABC transporter ATP-binding subunit UrtE | - |
EL032_RS10855 (NCTC12129_02485) | 2278859..2279263 | - | 405 | WP_002435658.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL032_RS10860 (NCTC12129_02486) | 2279263..2279568 | - | 306 | WP_002435659.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL032_RS10865 (NCTC12129_02487) | 2279648..2280842 | - | 1195 | Protein_2150 | efflux MFS transporter YdeE | - |
EL032_RS10870 (NCTC12129_02488) | 2281041..2281936 | + | 896 | Protein_2151 | O-acetylserine/cysteine exporter | - |
EL032_RS10880 (NCTC12129_02490) | 2282660..2282869 | - | 210 | WP_040459853.1 | multiple antibiotic resistance regulatory protein MarB | - |
EL032_RS10885 (NCTC12129_02491) | 2282902..2283276 | - | 375 | WP_002435664.1 | MDR efflux pump AcrAB transcriptional activator MarA | - |
EL032_RS10890 (NCTC12129_02492) | 2283294..2283728 | - | 435 | WP_040459814.1 | multiple antibiotic resistance transcriptional regulator MarR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11652.75 Da Isoelectric Point: 9.4481
>T286837 WP_002435659.1 NZ_LR134136:c2279568-2279263 [Atlantibacter hermannii]
MRKGTPNVPLSVVKEMVRSGKVKTTFTATQGALELGFPAPVLPLMCKVVLLLDQSHFYKSMTAYHDETIWHDVYRTRFDE
RHIYLKLIVKDDVLIVSFKEL
MRKGTPNVPLSVVKEMVRSGKVKTTFTATQGALELGFPAPVLPLMCKVVLLLDQSHFYKSMTAYHDETIWHDVYRTRFDE
RHIYLKLIVKDDVLIVSFKEL
Download Length: 306 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14921.97 Da Isoelectric Point: 7.6663
>AT286837 WP_002435658.1 NZ_LR134136:c2279263-2278859 [Atlantibacter hermannii]
MKTCPVCGGGHLTHESRDLPYEYKGSKTTLRGIVGEYCNSCGEIIFTPEESNAFSAQASAFRTAVNAESFDPTLFTRVRK
NLRIDQQQAGMLFGGGVNAFSRYETGKTTPPIAVVKLFKMFDKFPELFEEYKSL
MKTCPVCGGGHLTHESRDLPYEYKGSKTTLRGIVGEYCNSCGEIIFTPEESNAFSAQASAFRTAVNAESFDPTLFTRVRK
NLRIDQQQAGMLFGGGVNAFSRYETGKTTPPIAVVKLFKMFDKFPELFEEYKSL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|