Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1626105..1626751 | Replicon | chromosome |
Accession | NZ_LR134136 | ||
Organism | Atlantibacter hermannii strain NCTC12129 |
Toxin (Protein)
Gene name | higB | Uniprot ID | H5UXB4 |
Locus tag | EL032_RS07560 | Protein ID | WP_002463190.1 |
Coordinates | 1626105..1626458 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | H5UXB3 |
Locus tag | EL032_RS07565 | Protein ID | WP_002463188.1 |
Coordinates | 1626455..1626751 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL032_RS07550 | 1621501..1624624 | - | 3124 | Protein_1481 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
EL032_RS07555 (NCTC12129_01741) | 1624624..1625877 | - | 1254 | WP_002463191.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
EL032_RS07560 (NCTC12129_01743) | 1626105..1626458 | + | 354 | WP_002463190.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL032_RS07565 (NCTC12129_01744) | 1626455..1626751 | + | 297 | WP_002463188.1 | XRE family transcriptional regulator | Antitoxin |
EL032_RS07570 (NCTC12129_01745) | 1626774..1628127 | - | 1354 | Protein_1485 | molecular chaperone | - |
EL032_RS07575 (NCTC12129_01747) | 1628260..1629114 | + | 855 | WP_002463186.1 | DNA-3-methyladenine glycosylase 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13569.72 Da Isoelectric Point: 10.0566
>T286832 WP_002463190.1 NZ_LR134136:1626105-1626458 [Atlantibacter hermannii]
MTWTVVLTPEFEQWFDKQEAGLQDRINMMITLLEISGPNLGRPHVDTLVGSRYPNMKELRIQYAGEPWRVGFAFNHRQQA
VLLYGGQKTGKKRFYTLLIAQVDAIFARDLARKKETL
MTWTVVLTPEFEQWFDKQEAGLQDRINMMITLLEISGPNLGRPHVDTLVGSRYPNMKELRIQYAGEPWRVGFAFNHRQQA
VLLYGGQKTGKKRFYTLLIAQVDAIFARDLARKKETL
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|