Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1717072..1717721 | Replicon | chromosome |
| Accession | NZ_LR134117 | ||
| Organism | Serratia odorifera strain NCTC11214 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL065_RS08440 | Protein ID | WP_128135925.1 |
| Coordinates | 1717371..1717721 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | D4DZY8 |
| Locus tag | EL065_RS08435 | Protein ID | WP_004957249.1 |
| Coordinates | 1717072..1717371 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL065_RS08415 | 1712977..1713996 | + | 1020 | WP_004957238.1 | dipeptide ABC transporter permease DppB | - |
| EL065_RS08420 | 1714008..1714910 | + | 903 | WP_004957240.1 | dipeptide ABC transporter permease DppC | - |
| EL065_RS08425 | 1714925..1715890 | + | 966 | Protein_1628 | dipeptide ABC transporter ATP-binding protein | - |
| EL065_RS08430 | 1715903..1716898 | + | 996 | WP_004957246.1 | ABC transporter ATP-binding protein | - |
| EL065_RS08435 | 1717072..1717371 | - | 300 | WP_004957249.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL065_RS08440 | 1717371..1717721 | - | 351 | WP_128135925.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL065_RS08445 | 1718023..1719679 | - | 1657 | Protein_1632 | cellulose biosynthesis protein BcsG | - |
| EL065_RS08450 | 1719676..1719879 | - | 204 | WP_004957257.1 | cellulose biosynthesis protein BcsF | - |
| EL065_RS08455 | 1719873..1721435 | - | 1563 | WP_004957260.1 | cellulose biosynthesis protein BcsE | - |
| EL065_RS08460 | 1721639..1721830 | + | 192 | WP_004957267.1 | hypothetical protein | - |
| EL065_RS08465 | 1721834..1722562 | + | 729 | WP_004957269.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13368.54 Da Isoelectric Point: 9.6538
>T286823 WP_128135925.1 NZ_LR134117:c1717721-1717371 [Serratia odorifera]
MWTIVTRPRFDQWFYRQTDRVQEEMLAVLTLLQQDGPNLGRPQVDTLKGSAYGNMKELRVQTAGHPIRACFAFDPHRQAI
VLCAADKKGMGRRFYQQLIKTAMPSMPPICKTLENE
MWTIVTRPRFDQWFYRQTDRVQEEMLAVLTLLQQDGPNLGRPQVDTLKGSAYGNMKELRVQTAGHPIRACFAFDPHRQAI
VLCAADKKGMGRRFYQQLIKTAMPSMPPICKTLENE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|