Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2531792..2531976 | Replicon | chromosome |
Accession | NZ_LR134093 | ||
Organism | Staphylococcus aureus strain NCTC11965 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ELZ56_RS13060 | Protein ID | WP_000482647.1 |
Coordinates | 2531869..2531976 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2531792..2531852 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ56_RS13035 | 2527302..2527469 | - | 168 | Protein_2418 | hypothetical protein | - |
ELZ56_RS13045 | 2527700..2529433 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
ELZ56_RS13050 | 2529458..2531221 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2531792..2531852 | + | 61 | - | - | Antitoxin |
ELZ56_RS13060 | 2531869..2531976 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ELZ56_RS13065 | 2532110..2532496 | - | 387 | WP_000779351.1 | flippase GtxA | - |
ELZ56_RS13070 | 2532764..2533906 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
ELZ56_RS13075 | 2533966..2534625 | + | 660 | WP_000831298.1 | membrane protein | - |
ELZ56_RS13080 | 2534807..2536018 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
ELZ56_RS13085 | 2536141..2536614 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T286794 WP_000482647.1 NZ_LR134093:c2531976-2531869 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286794 NZ_LR134093:2531792-2531852 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|