Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2070501..2070924 Replicon chromosome
Accession NZ_LR134093
Organism Staphylococcus aureus strain NCTC11965

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag ELZ56_RS10485 Protein ID WP_001065091.1
Coordinates 2070673..2070924 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag ELZ56_RS10480 Protein ID WP_000028422.1
Coordinates 2070501..2070683 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ56_RS10435 2065887..2067548 - 1662 WP_000625088.1 terminase large subunit -
ELZ56_RS10440 2067545..2067889 - 345 WP_000402904.1 hypothetical protein -
ELZ56_RS10445 2068019..2068318 - 300 WP_000988336.1 HNH endonuclease -
ELZ56_RS10450 2068550..2068966 - 417 WP_000590122.1 hypothetical protein -
ELZ56_RS10455 2068994..2069194 - 201 WP_000265043.1 DUF1514 family protein -
ELZ56_RS10460 2069194..2069343 - 150 WP_000595265.1 transcriptional activator RinB -
ELZ56_RS10465 2069340..2069726 - 387 WP_000592207.1 hypothetical protein -
ELZ56_RS10470 2069723..2069929 - 207 WP_000195803.1 DUF1381 domain-containing protein -
ELZ56_RS10475 2069966..2070508 - 543 WP_000185659.1 dUTP pyrophosphatase -
ELZ56_RS10480 2070501..2070683 - 183 WP_000028422.1 hypothetical protein Antitoxin
ELZ56_RS10485 2070673..2070924 - 252 WP_001065091.1 DUF1024 family protein Toxin
ELZ56_RS14600 2070917..2071081 - 165 WP_000990744.1 hypothetical protein -
ELZ56_RS10490 2071096..2071338 - 243 WP_000131366.1 hypothetical protein -
ELZ56_RS10495 2071342..2071710 - 369 WP_000101274.1 hypothetical protein -
ELZ56_RS10500 2071723..2072032 - 310 Protein_1948 RusA family crossover junction endodeoxyribonuclease -
ELZ56_RS10505 2072041..2072259 - 219 WP_000338531.1 hypothetical protein -
ELZ56_RS10510 2072266..2073150 - 885 WP_000148316.1 DnaD domain protein -
ELZ56_RS10515 2073180..2073650 - 471 WP_000934764.1 single-stranded DNA-binding protein -
ELZ56_RS10520 2073651..2074268 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
ELZ56_RS10525 2074349..2075269 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - map / hlb / scn / chp / sak / sea / hlb / tsst-1 / groEL / hld 2037060..2120318 83258


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T286788 WP_001065091.1 NZ_LR134093:c2070924-2070673 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT286788 WP_000028422.1 NZ_LR134093:c2070683-2070501 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References